SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI79464 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI79464
Domain Number 1 Region: 344-502
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.55e-17
Family Retroviral integrase, catalytic domain 0.0067
Further Details:      
 
Domain Number 2 Region: 224-263
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000244
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  164328.JGI79464
Domain Number - Region: 28-112
Classification Level Classification E-value
Superfamily Hypothetical protein YhaI 0.0785
Family Hypothetical protein YhaI 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI79464
Sequence length 834
Comment (Phytophthora ramorum)
Sequence
MPKPTTDASWEVEVSEKTGRPVRWNGQNFQYYKKLMEIAARKNDTDLYKVMTQQIKYDAN
FTSLQKMCTDMGQQLMDMTDGSTMWKYLCDRYEGTANDQTRAMTKRQLYAQLESAKCKQS
GKVEGHLNYMCRLKGRLKTVGMTVDDAVFSGMLVSSLPSNERFDRLRGFVDAGMDCVDTP
EKVVAMAVTFDKANQAEEQMHRLFGAKQSFGQQNKGGGGGGQGKGGNERASPTGQRKSRS
CFVCGSTDHLKASCPEKAKKQSGVEGNEQQRRPRSNCMLCQDGNTSPDVALSDEEVVAEG
VVTGIAMSTRPEESRGDESGDDQEAEVAELHQEVNDQEDAAVVYADLLFPGKGNGSRFEA
LLVIIDGYSRLVTVHMLMNKSSEVVNNYLKEYVLWAESQAGRMIKKVITHKVMQVLTDKG
GEIVNEAMEAWYNSRGIEHIQVGPKSSQLNLCKRTHQSLVEMTKAMMEQSGLPRSLWPEA
MRNAVYIKNRSNNKGTQGVPYEMFFGAKPDVHHIRKFWALAYVHILVTPSRRKRNSNAKL
GYALGYAENVVGCKVFFPAEHTAKFVSDLRVAEEVVSTWIKIMDIMVEDLHFQAAHKDGE
EPDAREAREVDQMHSRQAAGNEPLTDAADEDESESVAGTYGSSVADEDPEVAEDSGNASD
EDVTVASVFVEDENGMDTYVESVHSELEKDTGEVNLSDGSGSGPMETVDASEMFDFLPCQ
TGKRKHRGETPSEEERVEKGADKTEPKRTRTGLREYHERRRPGYLDDYVANLTLKTCEAS
QVKVPRNRREMLRSKWREFFLMEEMEEMAALKDKGVIEEISEDEIPKDAKPVDT
Download sequence
Identical sequences H3GRH3
164328.JGI79464 jgi|Phyra1_1|79464|fgenesh1_pg.C_scaffold_40000077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]