SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI79467 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI79467
Domain Number 1 Region: 601-853
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.67e-62
Family Reverse transcriptase 0.0021
Further Details:      
 
Domain Number 2 Region: 978-1083
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.47e-20
Family Retroviral integrase, catalytic domain 0.032
Further Details:      
 
Domain Number 3 Region: 1233-1300
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000623
Family Chromo domain 0.0055
Further Details:      
 
Domain Number 4 Region: 383-480
Classification Level Classification E-value
Superfamily Acid proteases 0.000006
Family Retroviral protease (retropepsin) 0.028
Further Details:      
 
Weak hits

Sequence:  164328.JGI79467
Domain Number - Region: 287-311
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000167
Family Retrovirus zinc finger-like domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI79467
Sequence length 1349
Comment (Phytophthora ramorum)
Sequence
MDEQPMQHGDSMQQLFASLAAMMHEQQQQFMAQTADLQRQMAATLQQQQAPPQQQQQQQS
ESPAVDTREYRAEGITMPKFSGTKEDDVGDYMFSAKLYFESKNIKYGSEAPQQRPLSLLV
ANLKGPAAAWYREYVFHDGHFLHSVTQFEEFLTSEFTAPDRQEHLRNQLLRLRQRNCSCL
EDYVATFRGLICKVEDMSDIDKVMHFQKGLLTDIKQEVKLRQFRTTTEAISFALMYDRTH
FVSSRQLGRTGHQSSQCRSSPQPRQRMEEQPTPMEIGNARIISRQECMRRNLCLYCKEPG
HRLADCRKRQARNSPRGPSRPPHGRSSFRANQSSFRCVVEAQDDSDDEEDFVDDNDNLVE
VIDSLQLMVSVDSVAPSKRELLRFEGMMNDQVVRVLIDSGAERNIVRPGLAQHFVDAAKV
TAERFDGTTTPARTVHRCCETLSFDGREFADVSLIEWEVSSNQVVILGHPWLVQFNPIIN
CQTGVMRFPRPRLVLDARSINDSLDVAPPTVAAVEVTSELLQHPLPSNLRQQLNDHIKAG
YFHMPLGPSSIASLGCRPSPHGSGKDGDNQAATPLCVISAAQFATKVKAEEYVELYHVTV
EQEALDIFVAELLKKNWIEVSDSPWVSNIFGMPKKDPSTGKFPSRPEWLHSNNPHMAIRW
VIDYRLVNAASEVAKIPLPYIEHLFDRMNVAPMGLARIPGSWTRLMRKVLSHLAFVVVYL
DDICIFWRSMADHVEHLQRVCEVLRQHKLYARPDKCDFGQRSVDFLSHTISVDGLHVDAR
KTRAIAEWMEPSNIKDHQRFVGLAGYYRRFIHRFATLVLPLSALVKKDVPWAWDDTQRQA
FNAIKLALQHAPPATELHDVGTAQLRMRVHAVSTAGSTVTKKAFQKAYDRDPEFKHLWKY
GRTSEEYEVVHGLVYLKSNDNLRRFCVPNNRKLRVDVIHNAHDAAIMAHPGIRRTQLAAA
QWYFWPSMDLDIKAYVQKDTAKLFFNNVIRYYGIPSTITSDRDTKFTSRFWTVLVNLMKI
KAAITTAHRAQADGQTERQNRTLEESLRCSISYHGNDWNEHLPMIEYAHATLVSSSSKLS
PFFVDTGRKPTYLLDTGADAASVPHSRVEHASRFVQHRQEVIERARKNLLDAHATQKKFY
DKRRAENPFKVGDLALLSTQDLKISHATAETTLRSRKFIPRFIGPYAILEIRGNVALLDL
PANLKSLSPRFNIDKLKVYTSNPDRFDGRMISKSTPVIFDDDGEPLHVVEALIKRRTFNR
QPEYLVKWYGLPHHENTWERERDIKHVSRWQALLKDLCRRSQARACGILFMRGFPVMFLT
TRDYGTTNFNFDDFILKQMRWISLETFTS
Download sequence
Identical sequences H3GRH5
164328.JGI79467 jgi|Phyra1_1|79467|fgenesh1_pg.C_scaffold_40000080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]