SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI80087 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI80087
Domain Number 1 Region: 191-219
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000558
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI80087
Sequence length 245
Comment (Phytophthora ramorum)
Sequence
MSVPTFDGKEADSLVFWIREIEIALSAGQIYESRAQVAFALSNLGGRARAWAMARETSSP
GYFTSWAFMEQELRSTFLLANVAYRYRSLFLRCKQGKRTLQDYVMELQNLEAAMAGAPLS
EDVKVTVFMDGVRPGPVRTELFRRQPTTFNDAVHIAMLEDHCVRSAQGYAGRAEATEDPT
PMEISSAESARPQRNQRASGRCFGCNQLGHFRRNCPTNPWKTGRGKAAPSLNVIESAVSE
NGDSQ
Download sequence
Identical sequences H3GSS6
jgi|Phyra1_1|80087|fgenesh1_pg.C_scaffold_45000086 164328.JGI80087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]