SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI80096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI80096
Domain Number 1 Region: 476-640
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.61e-30
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 2 Region: 210-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000774
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI80096
Sequence length 799
Comment (Phytophthora ramorum)
Sequence
MSSAHDASTKVSIDKFNGDNYATWNRYMRGVFLTKSVWHVVNRDTTPSFTDSRPKDEYVK
SSNIAFGLMLLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSE
GGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSCAELRSQD
VVKVLTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCLTKQKDENR
GPRRGGNGNGRGRGANNAQWRNDDASHDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDS
GATHHICNDKAKFAHLIERNEGELSVTDGNKAAIMGVGTIVERVVLPNGDERDVEIKNAL
YVPSMNKNLLSVPQTNKSGLFQVVFDGAQMRVAHKASKQVVAAANLVDGLYWLQTSQRSA
NAATSGKTVDLHARMGGGASQDGRQRHDQGREGTFQVEWTKRKMVQKPFPSNRDKRRYDT
FELLHFDICGPMEEESLGGSRYLLLIVDEASGCMKGFCLRAKSESEDCIKTYVTKVQTQF
GKKVKFVRHDGAREFATNSLKAFYEVEGIEQQTTVPYAHQTNGTAERAIQTTVTIGRSML
HHAKLDKCFWAEAAMTAIYVKNRLPSPKVEHKTPFEIVYKSKPSVKHMRVFGCQTYILTP
KEKRRKWDPKARAGLFLGYEEVSKAYRLYDIEAGQSVFGLSAHTSDEDVDDAALDLDDND
GPRQVSFKQAEKRKNRPSGDDDTAIRSCPVRHRAGLEEASAPDVSSSRRAEPDEEEKSGD
QDGDDGSTPPVGQRAIGTK
Download sequence
Identical sequences H3GST5
jgi|Phyra1_1|80096|fgenesh1_pg.C_scaffold_46000007 164328.JGI80096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]