SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI80189 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI80189
Domain Number 1 Region: 334-418
Classification Level Classification E-value
Superfamily RING/U-box 2.53e-16
Family RING finger domain, C3HC4 0.049
Further Details:      
 
Domain Number 2 Region: 246-270
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000209
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 
Weak hits

Sequence:  164328.JGI80189
Domain Number - Region: 1512-1575
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00432
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI80189
Sequence length 1648
Comment (Phytophthora ramorum)
Sequence
MSIHFKFKSAKEFDTVTFPGAVIRVLDLKKAIVDKKKLAKGLDFDLVITDAQNGKVYDDE
TTQLPRNTSVTVKRIPSQQPGSGLLARMKQEAAVAAAAAAAMAIHASPPVAPMAGPSPVL
PVGPTPTQPMASLSLSTGDAAGAQTMEDEMAALQSIHEQAEDMRGSRLGNKTWTASTGSN
ANHVMNYYAANGPGGDAGGRGTGAGGRGFGRGGRGGDFGGRGGMMNGRGGGRSGPGAPGG
PNLLGNPPPNYVCYRCGTPGHYIQNCPTNGDPEFDQHRVKKKTGIPKSFMKAVSDPSEIP
VGAGKTVVNAPWGGLAVIEPQNKNFSKLMARSGGSATLDQFISNPPEHLACPLCRRLMSD
AVLIPCCQESACDECLRSALIERKLTCPLCNVSNMSPEKLLPNKVLRTSVDEFLRRARTE
QQEREQLVKEAEEKALAKQKAAEVAASSATRRSGDSADATLEIKKGKKGDAEEDEEDEFG
GDIFGDGDENEDGSSPQKSGSPSQPPQQPPLPTEDGAAATGEEDLGDPSRKESDASSTGN
GQAAESTDKGSPSSRSQGPPSGNGMGPPGSQMPWGPDGPRGPPMGFNGPPGPWFDGPPRG
QPGPWFDGPPGPWFDGPFPGGRGGRGAMKGGRGGGRGRGGMPPPGYFGGPGPDYFGPPPG
HPDYFGPPPPWFDGPMPPFGGRGGGGDRWFEGGERKPPRGRDEERRRNRSTSRDRDRSRG
RDRSTGRDGRSERDRRGGDGKPSDKDSRGSRGSDRERERSKRSRSRSRSHKPARAHGRSR
SRSKSRSEKKSRERTSSSRASSSRRSRSTSRGRHHREHKNGNSQEDAKPAKEPGTSSDKD
KKPKEEEKKQESTVKDVKLDQVAAPAIDLDFLAEPMDEDVPSDNETPRPTTPAKLDRKKS
DESMTDKDTKDAKDTKDAKDTKDGKDNDKKSPRGDDARDKKEDSGRSSSRRHDSPTRSSR
GRDRDRGSTSEKRGVSRSRRSRSRSQSRRDSSRRRPEDNRSSSSRAKDRSSGGDRDRERD
RERSDRDRDRGRDRDRERPREKDRPRDRDKNERERDRPRDRKERDGKRSRDAADGKRGRD
AADDGRKERDEKRGRDAADDGRKERDGKRSRDAANDDRNGKRGRDAADEGAATGGDRKRR
RSVEKERERRGEKGSGGGGRVVTATSGSSRGSRGGRNRRRGGDDDKRRIEAEADGKGGGN
DRKRPPRKKSDDRGKASGETPAKKRSVLDRLGPKLYPTSVWNAHNAFCEPLAMFGPDRCP
QIKLTPEDRALYDHAARKFLQDTVAERAKFNPKNVDPQHWAFVKRRKEVSVFNSVPGSTN
QSIIVMVGTGLIDGRIEDVMSGLYCETTDELRTAKVLLGYDLKDGSVLNVHERRTPDDPF
RFAGIKWFAGRCAWGLLHDRDALTYERMGTTTDARGHELTYHTLQSIKRPEWPSEATPGM
LRQHTASCYLYRRHKRTNKTEIFLWGSILKFGSAPEKAIQLGVASTWLNVVNSPRGGRAK
KFSALMDEADSHQWLPSSTICHVCTCKPKLGSYPQCSGCHQTVCRDCSEQHHIFLLSKSG
RSKKRLFCAMCVKNVTGKAHLGPRSNPFGSSYDSSECSTSGTDSLSSSSRSSNSFLSRTF
SFKRPPDPFRPRVSPSDDEAPDELDLDW
Download sequence
Identical sequences H3GSZ8
jgi|Phyra1_1|80189|fgenesh1_pg.C_scaffold_47000011 164328.JGI80189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]