SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI80409 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI80409
Domain Number 1 Region: 392-561
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-34
Family Retroviral integrase, catalytic domain 0.0023
Further Details:      
 
Domain Number 2 Region: 193-225
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000628
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI80409
Sequence length 676
Comment (Phytophthora ramorum)
Sequence
MEPFDGSNYTLWSYKMKMYQMSKGLWEAVEGKAEASSSKEQQAHAAIVLNLNDSQLMHVV
TAKSAKEAWEKLEKFHRAQDVANRLWLKEKFSSFKFTTSSVSKHVTELEQLVLEMKSAGC
EPSDEDVCATLLRSLPASYESLVQAFRMSMTELKLADLVGKLIAEEVRQKDSTRIKEATA
LLANKGYAKDTKKKQQGGRRKLSGACFNCGKMGHYARDCRSKASPENEVLDESNVTFNVT
EMFASESWVMDSGASTHMCKTREAFEDYTPMTKSYTATAHGVTVIMTQDKCVIKRGDVSV
ATGRKIVKLMYLNTDAGEECHIVEEDVGLWHRRLGHASFQTLNDMIKDGRISGTPAEKGN
VCGVCATAKQVRKTFHSNKGELEARESKRTDDIVCSDVLGPITPASKSGYKYIVTFIMMK
SRYVTIYPLRMKSEVHDAFAKFLKEIKVTAGLTVKILRSDKGGEYRIANMDALCDAKTIK
QEFTVPYNPQHNGMSERMNRTLVEMTRCMLKESGLDKSYWCEAIMTATDIRNVLPNTSNP
HASPFEMVFKRKPRLDHMRVFGSECYASVTKEKRKKLDDSGVKCYFLGYAKQSKAYRLLN
DSDGSIVVSRSITFAEHSSDKVATEKGDVIDIIGEDDDKDTQDEQGVDDGFSTPTMEPQQ
EPQQSEHAGPTHAVPT
Download sequence
Identical sequences H3GTF6
jgi|Phyra1_1|80409|fgenesh1_pg.C_scaffold_49000015 164328.JGI80409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]