SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI80695 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI80695
Domain Number 1 Region: 100-388
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.04e-78
Family WD40-repeat 0.0000565
Further Details:      
 
Domain Number 2 Region: 503-552
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000113
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 
Domain Number 3 Region: 453-497
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000563
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI80695
Sequence length 676
Comment (Phytophthora ramorum)
Sequence
MQENGELHPAQVLKSGHDVGSSQYAGGVPPHKRMRKPIVRKSVDPNATFINYVTQRRFVL
ARSVRSHALPPHSFYKKQMLPPLAYPGDDDLTSCVCTKFCRCSTNKQRCPVNCLTWTPEG
RRLITGNSVGEFTLWNGLAFNFETILQAHDDAVRAMVWSHNDNWLVTADHGGVIKYWQSS
MTNVQLLQGHREAVRSLSFSPTDFKFVSCSDDATVKIWDFESGREERVLTGHGWDVKCVA
YHPQKCLLASGSKDNLVKIWDPKSGNSLNTLHGHKNTVFKVAWNSNGNWLLTASRDQLIK
IYDIRMLKEFATLKGHAREVTSIAWHPWYERLFVSGSYDGSLMYWEVGKDNALASIPQAH
DTAVWDIQWHPAGHVVATGSNDHSTKFWCRNRPGDPMDDKYNGGQTVLNEHDVGDGMMHM
RQGADGAEVLPGMADGASSLRSSAINAANFQTFNSSSTDNRGNGGRRPPPESYTCNRCGT
KGHWIEDCPTKDQHGPSGQMQRKVPPEGYLCKRCNVPGHYISDCTEPKVPPPSYTCHKCR
QKGHWKQDCPMDGNGTISALLSQIRPPGAAMAPISTGGVGSIPPPPLSARGFPRGMMPPP
PPAAGGPGLLVPPPPPPHILAGMKRAREDEPVGMPPPPMNGWPPVAGGRAPPGPPGMLNV
PGQPDLKKISRDPRRR
Download sequence
Identical sequences H3GU25
jgi|Phyra1_1|80695|fgenesh1_pg.C_scaffold_51000078 164328.JGI80695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]