SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI80841 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI80841
Domain Number 1 Region: 1398-1738
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.11e-100
Family Reverse transcriptase 0.00018
Further Details:      
 
Domain Number 2 Region: 546-850
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.56e-82
Family Reverse transcriptase 0.00047
Further Details:      
 
Domain Number 3 Region: 93-121
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000262
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI80841
Sequence length 1748
Comment (Phytophthora ramorum)
Sequence
MARYLVSNIVTNPIDEATKVVTFMKGLRDWPVKTYLFREYPNTLEAAIALAMQEEFSLRQ
AKLHVNAPRLLPRPVVRPSGGPEPMDLSSATAAGSQQRHGSTNVRCFRCGNIGHYARECA
RGEEPSWRYWVSSRAIKKLEGPAGAGRPAGDAIERVDIGHAAMKITAPSESQSHCKKQDD
KPNLVILKKEFVDELIVLELDDKFDMVLGMPWLARHDPVIDWTKRTIMRFGSSSSATESD
GPVGAAHAPRGACGPPLETARNAAVSGHPMRTPTTARVVGRRCEPNQQGLVQSDSRGSRS
VRGDAVVSTGNVDTQLVERHSAVRRRGKEDASALGADAASSADGCKRPAPEMLASSRAAG
LHDEAVRDQAGLERVRPRVKPAGEYKEQLSTAGPGQEETRGAGLRTKSERCKLSKLRKSR
SGTETLQAVSAGQTQELETTVETLSVLTRTSIGLQYKKMRLDNPPTLASELMLLPVTSWK
RFARELHDGRIEQICILSDVERMTCEAEELNQLISEGADALSAKSKKERFDEQGWDSLKA
SPFYKVLREYKDVLPDDIPAELPQDKGVQHEIDLVPGTKYYVTRQWPLPREQVKAIDDFF
ESRRKAGQVRESKSPHSAPAFCVMKPQGGWRIVHAYNKLNDATVPAQTPIPRKDVIIDSM
TSSTIFSTLDLRDGFYQILMRESDIPLTAGLKNAPATFNRCVTHLLRSVRDFAPSYFDDV
FIHSRAVNGKSDVEMHTEHLRKLLELMRKHKLYANLKKCIFGATEIPVLGCLVGKNGELQ
QFLGLATYLCKYVSNYAGKIRPLSQLLKKEAAWEWTADCQQAFEAVKQGLTEAPILAVAD
QDRPFHVVTYEEFKEELKLAFEPPQNEFRSRAEFLDLQQGKHDVHAYAQRARYLVSNIVA
NPIDEATKVVTFMKGLRDWPVKTYLFREYPNTLEAAIALAMQEEFSLRQAKLHVNAPRLM
PRPVARPSGGPEPMDLSSATAAGSQQRRGSTNIAAPSESQSHCKKQDDKPNLVILKSLPR
LDFEEDKTPRGLLEVRLATGVVVRTEKRIVRVRFSYQEKEFDDELIVLELDDKFDMVLGM
PWLARHDPVIDWTKRTIVRFGSSSSATESDGPVGAAHAPRGACGPPPETARNAAVSGHPK
RTPTTARVVGRRCEPNQQGLIRSDSRGSRSVRGDAVMSTDNVDTQFVERHSAVRRRGKES
ASALGADAASSADGCKRPAPEMLASSRAAGLHDEAVRDQAGLERVRPRVKPAGEYKEQLS
TAGPGQEETRGAGLRTRSEQRKREKLRKSRSGTETLQAVSAGQTQELETTVETLSVLTRT
SIGLQYKKMRLDNPPTLASELMSLPICILSDVERMTCEAEELNQLISEGADALSAKSKKE
RFDEQGWDSLKASPFYKVLREYKDVLPDDIPAELPQDKGVQHEIDLVPGTKYCVTRQWPL
PREQVKAIDDFFESRRNAGQVRESKSPHSAPTFCVKKPQGGRRIVHAYNKLNDATVPAQT
PIPRKDVIIDSMTSSTVFSTLDLRDGFYHILMHESDIPLTAVSTPSGMLWEWLVMSQGLK
NAPATFNRCVTHLLRSVRDFAPSYFDDVFIHSRAVNGRSDVEMHAEHLRKFLELMRKHKL
YANLKKCIFGATEIPVLGCLVGKNGVRPDPGKVRVINEWPTPSNVKELRQFLGLATYLCK
YVSNYAGKIRPLSQLLKKEAAWEWTADCQQALEAVTQGLTEAPILAVADQDRPFHVVVIV
WFTTNRVS
Download sequence
Identical sequences H3GUE6
164328.JGI80841 jgi|Phyra1_1|80841|fgenesh1_pg.C_scaffold_53000034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]