SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI81335 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI81335
Domain Number 1 Region: 192-225
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000641
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI81335
Sequence length 294
Comment (Phytophthora ramorum)
Sequence
MEPFDGSNYTLWSYKMKMYLMSKGLWEAVEGKAEATSSKEQQAHAAIVLSLNDSQLMHVV
TAKSAKEAWDKLEKFHRAQDVANRLWLKEKFSSFKYTTSSVSKHVTELEQLVLEMKSAGC
EPSDEDVCATLLRSLPASYESLVQAFRMSMTELKLTDLVGKSIAEEVRQKDSTRIEEATA
LLANKGYAKDTKKKQQGGRRKPSGACFNCGKIGHYARDCRSKASPENEVLDESNVAFNVT
EMFASESWVMDSGASTHMCKTREAFKDYTPMTKSYSVASAKSSAKLKVLGHGTV
Download sequence
Identical sequences H3GVH0
164328.JGI81335 jgi|Phyra1_1|81335|fgenesh1_pg.C_scaffold_58000098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]