SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI81878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI81878
Domain Number 1 Region: 761-988
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.39e-59
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 991-1149
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 7.6e-43
Family NADPH-cytochrome p450 reductase-like 0.00034
Further Details:      
 
Domain Number 3 Region: 287-359
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.71e-17
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0092
Further Details:      
 
Domain Number 4 Region: 547-654
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0000000000000523
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0013
Further Details:      
 
Domain Number 5 Region: 71-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000182
Family PFOR Pyr module 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI81878
Sequence length 1149
Comment (Phytophthora ramorum)
Sequence
MSTAANYQAEEGLAAVSVGSSAAPIKAALAVDVVDENASDTSTASLVPTPLHKQRAARLE
LSGRVFPRTDRFCSGADAVLHVAGHVSNNVFEYPLLTAADSEQTQEAKRNARARVVTLEI
RAGAADAVRGALSVGASASALIPSQTLPLFLPSLFQLAQSAATSAPAVFHVACEAIRRDM
AVASSYEPLYALQHSGALLLNSASPQECHDMAVVAHVAAQRLHKLLVHFYDGARVARELA
KVEALTEESLETLSTSSSGVSQTGDVVEQVQNVMDDLFHVLQRQYRVYEYFGAEDAEYVV
VVVGEAAAALKQAAAYEQMLGGKVGVVQVRLLLPWSHKLFAEALPATVKRVVALENVAPS
ALTFQRGLLTQNLQVFFHSTYWQPAVETAPVVVTGVYGGVFRNSVFSVGMGRAVLRHLAT
SASRRAFVVAKTEELYDAALVDPASASNQATKFDVVFGEALELEGSAAYTKQFLFYGFDD
AEADSARAGTETNKLFESTLDLLNKNPATRVNAVVTHSAGEEAAVRPVSTLEVRVALDGG
HGPATSEPVEQADVVVVTRPELLVHYDVASSVKQGGKLLVLAGWKTSDDVDERAAFKQQV
ASRDVQLLVVDTNELATRVEDDAVAAVGLQTAFFKASGLYDENVVLALLEAQFPAEKHSV
LRSFVSAVWGDVLTLTYPSSEWLSATDVDEKVAAEPLTAFSSVATSKVPFANSPESTTAS
KTGGKRRSYAEVSRETKTAWQIMFPGSYEARHGVRDHVTDLVTVTKWERLTPEDYSRNVF
HLEMDTTNTAIKYRIGEALAVFAHNDEKDVIRFLQTYNVDPEALVALPVAHKKKKGEAAT
GPSEETLTYFQLFSHVLDIFGRPSKKFYQALLERATNEKEKTTLTALLDADGKDEYKRRV
DETVTFAELLEEFTSARPNLADLLTLVPRIKPRHYSIASSMKMNPTSVHLLIVVHDWTTP
DGKYCIGQATRFLSGVKVGQKLSVSVCSSVMKLPTNPEDPIVMAGLGTGMAPFRAFIQER
AFLRSQGVKVGPVALYFGSRHKAKEYLYGEELDAYEADGLVTYLRCAFSRDQEHKVYIQD
KIAEDKEILADLLLRQNGHFYLCGPTWPVADVREALVSSFTQVGGLDRRQANATIERMRE
EGRYVLEVY
Download sequence
Identical sequences H3GWL4
164328.JGI81878 jgi|Phyra1_1|81878|fgenesh1_pg.C_scaffold_65000014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]