SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI81936 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI81936
Domain Number - Region: 452-480
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00107
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI81936
Sequence length 640
Comment (Phytophthora ramorum)
Sequence
METGSSSVRVFDGTTDFRVWRARVENELMRYHLLGYVLVRGYDGSQSFSFNGEQVPPRYP
VIHVDDDMQQSVVKEETPSCGRQGGAANQQGRLSRWDVLGESAEAKSILQRFLHPDVECA
ILNKNIYDSWKMLCALYGNRSNPGAHDVYEMHRVLHHIRLGDKKGEPVREFVTRWEMLMQ
QYALATGIDLTDGFRSVSLVQTLPSAWRPMVESWRGVRPFVPYPELVDKVIATRERMQAE
TEAANAPTPTASRLANGSTSSSVDTHTNLLPDKSAASVQPVTRPAANFVETAVDNAVDKV
VEKHASKPAERRAAEVPKVSETATKPSKSVPPTINVMAEANNTVDLTSGELSSSSETNKA
RASRSLNTAKKSPTERSDIATTPRTSKPPEEKGIHEKSREENDGYDKRESYGKNSKYESV
RGYSKYGSHDRYDKSPRTSRNRYEKKYDSYDRFDSNKSGPVSCFYCLKVGHHMKRCWYLK
ADIENGTTHDLHKKFSCAVTIDRNEFMVKCLESYIDEENRARASYGASASTPRSHRDYEV
MESVGRIYNSQQQEFVPLPGQPPSYAFRSDQQSASASSAAPDYRKRSHSVFQRVEDRISS
RGPRLNRSRSVYRSTDVAEDFSPRKRSRAPSFERQLQGYY
Download sequence
Identical sequences H3GWR9
jgi|Phyra1_1|81936|fgenesh1_pg.C_scaffold_66000013 164328.JGI81936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]