SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI82275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI82275
Domain Number 1 Region: 626-912
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.11e-73
Family Reverse transcriptase 0.00048
Further Details:      
 
Weak hits

Sequence:  164328.JGI82275
Domain Number - Region: 263-283
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00733
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI82275
Sequence length 938
Comment (Phytophthora ramorum)
Sequence
MDRSAFPHLNDSQFESVRKITGIFGMDALQSLAAATPADQLERVSAFDTYEQGLIAHPKP
LRLKVNPYEGKEGENLHFWVREVELAMNAALVSDERLRVAFALSHLSGRAKSWAYTREAT
TPGCFASWAQLCEQLRAAFLPANYEYRQRSRFLACKQGRRELHEYIQEMRELTASLVGNP
LHEHIKVTVFMDGLRVGPARTKLFRVQASTLEEAIQIALQEEYSHRQARTPTTAWLGGST
QGGPQSRGPFNGPVPMDLSLAEQHDIRCFGCGKLGHMKLEVPKVFMDLSVKFEDFNSTER
FLVLDMDKYDLILGMPWLENHEPWIDWRGKAIGASRPAATDRALVSHVPTSVSSRAYHRS
RVGNDSEELVAAGAATGVMTPSTAGNGPPQAMPVDRTSSPARGTAMPTVPTAPDYGTVRP
SALSTPGKVNSPRETSPRETKAVETVARVEVAGSTSSVGNNVPHGVDGTPDSIPESPPAV
GNNGPCRGGHRRRHRRRKPSLLRQTGVATSDSERENSPQARPAEECYHFFDGETGCTVKA
GSTTLAALPEVSELLNLEEMSMDDFLAQLKAGSIAEMVLLKPEASPEELSSSSVMDKDVL
DELVKKRATRTGSAVLENPKDPVYPLVKEFSDVMSKDPPSQLPPDRGVRHEIDLVPGTNA
TVPAQTPIPRKDVLLNNMAGCELYSALDLVDGYYQILMRERDIPLTAVSTPSGMLWDRAG
EGKTAIEVHLEHLRRVFMVMRANKLYANIDKCVFAAQEVKVLGCFVSSVGVRADPEKVKA
IAAWPTPRSQKDLRKWLGLANYLHKYSAGYAGLARPLSDLLKKNADWRWESRHQDAFNSI
KASLQRAPVLALPDETKPFSVVCDASDYAIGCALLQHDADGHERVISFQSRQLKAAERNY
PVHDKELLAMKPRVLADGHQLSASVSEDGPLAVILRGI
Download sequence
Identical sequences H3GXG2
jgi|Phyra1_1|82275|fgenesh1_pg.C_scaffold_70000003 164328.JGI82275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]