SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI82717 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI82717
Domain Number 1 Region: 652-1009
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.67e-112
Family Reverse transcriptase 0.00017
Further Details:      
 
Weak hits

Sequence:  164328.JGI82717
Domain Number - Region: 260-284
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000349
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI82717
Sequence length 1181
Comment (Phytophthora ramorum)
Sequence
MSVGSPNTSATHVARADCPHLSEPEWEALQRLSAVIGEAAVATMLRTLSPTEQHGVALGF
IVKEQRETAARTSVSPSATPRVESLKLHVDTAIAARRIVDPLSKVAFAMSCLGGRARSWA
YGRRLTGPTCFSTYEEFKEELKQAFEPPQNEFLDLQQGKHDVHAYAQRARYLVSNIVTNP
IDEATKVVTFMKGLRDGPVKTYLFREYPNTLEAAIALAMQEAFSLRQAKLHVNAPRLMPR
PVARPSGGPEPMDLSRATAAGSQQRRGSTNVRCFRCGNIGHYARAGRPAGDAIERVDIGH
AAMKIAAPSERQSHCKKQDDKPNLVILKEFVDELIVLELDELIVLELDDKFDMVLGMLCL
ARHDPVIDWMKRTIVRFGSSSSATESDGQHMHRVGLIQSDSRGSRSVRGDAVVSTDNVDT
QFVERHSAVRRRGKEDASALGADAASSADGCKRPAPEMLASSRAAGLHDEAVRDQAGLER
VRPRVKPAGEYKEQLSTAGPGQEETRGAGLRTRSERRKREKLRKSRSGTETLQAVSAGQT
QELETTVETLSVLTRTSIGLQYKKMRLNNPPTLASELMSLPVTSWKRFARELHDGRIEQI
CILSDVERMTCEAEELNQLISEGADALSAKSKKQRFDEQGWDSLKASPFYKVLREYKDVL
PDDIPAELPQDKSVQHEIDLVPGTKYCVTRQWPLPREQVKAIDDFFESRRNAGQVRESKS
PHSAPTFCVKKPQGGWRIVHAYNKLNDATVLAQTPIPRKDVIIDSMTSSTIFSTLDLRDG
FYQILMRESDIPLTAVSTPSGMLWEWLVMPQGLKNAPATFNRCVTHLLRSVRDFTPSYFD
DVFIHSRAVNGKSDVEMHTEHLRKLLELMRKHKLYANLKKCIFGATEIPVLGCLVGKNGV
RPDPGKVRVINEWPTPSNVKELRQFLGLATYLCKYVSNYAGKIRPLSQLLKKEAAWEWTA
NCQQTFEAVKQGLTEAPILAVADQDRPFHVVCDASDFAIGCALMQLDHEGRDHYNFQVEY
KPGRLNVVADALSRRSDYAANEADANAVGVVRTTTPSSSLLDDVKAAYAHDADAKQLLEY
FSTPSDKSRQKLAKHLRARVHRYRVHNGLLLYSAIDDNADRIVVPDDHELKLKITYEYHD
APTSGHPGREKTYLLLTRDFYWSHQYKWVRKYVRACEYQPR
Download sequence
Identical sequences H3GYE8
164328.JGI82717 jgi|Phyra1_1|82717|fgenesh1_pg.C_scaffold_76000035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]