SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI82802 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI82802
Domain Number 1 Region: 231-256
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000153
Family Retrovirus zinc finger-like domains 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI82802
Sequence length 286
Comment (Phytophthora ramorum)
Sequence
MERIPPSKSNAFDTYERELIAHVQRNLEASVAEPKPVQPKPLRLAVPAFEGKEGENLHFW
IREVEIAMRAGLISDQGLRIAFALSNLSGRANNWAYTLETTSPECFASWEQLCERLRAAF
LPANDGFRQRSRFLACKQGKRELYEYVQEMRTLASSLVGNPLPEDVKTTVFMDGLKVGPA
RTQLFRVHESTMEEAIKIALQEEYSHKHAGTPVVAQLVAANNELEPMDLSSVELGSVRCY
KCGGLGHYQRVCPSTGVGKNQSLKPRGPNGRWRKPRPGGRGNAGHK
Download sequence
Identical sequences H3GYL3
164328.JGI82802 jgi|Phyra1_1|82802|fgenesh1_pg.C_scaffold_77000052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]