SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI82870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI82870
Domain Number 1 Region: 580-728
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.78e-38
Family Reverse transcriptase 0.00044
Further Details:      
 
Weak hits

Sequence:  164328.JGI82870
Domain Number - Region: 173-195
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0331
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI82870
Sequence length 733
Comment (Phytophthora ramorum)
Sequence
MTAVTASTTPKPASDGAPRAKPLMVSVKTCEGRKEGENLLLWIREVEMAMASAILQTEQQ
RVALAVSKLGGRAREWTLTCGTSVDSAFPSWEQLKLRECSRRLTRTNACDHASWLPAKER
RSWWTLSKSYELLLPTNSSGAAGFSGGPEPMDLSHAEDEETELLAAEQRIGIRRCFVCGS
TQHLRPGCPLRKQHQAPASRSPASYQKPGAGRPTGEELSSVEPQQGGQQGLAPKSTVLFN
TERVCKPGLLVVEATVKGFDKPWTILIDSGASGNYARRSTMEGSRQYAEALVARTSDIIT
VRLATGTRVTVPKVPVSLGVKFLDFDSVERCLVLDLDSRYDLILGMRYWREHWTETVNVL
DIGVSELIDTRDVVDKSPEGAAADGMVGSKPRHRGYGPDDARRAARYPLSGERHDGEESL
RANDGAVGHEPRHPGPSPNDACGVAHNPLGGDCELCSSSPDVEFDVDAPMEQQEVETPEA
TFGVNMQASPWLTGEVAGDVSLEAVPAADALLELDEMSIAEFGEALKAGELAEVAIIQPE
DELNSSSLMDETVLEDTKQALSARSGSAILKDPSDPYYPLVKEYQDVVSNDPPSGLPPDR
GVRHEIDLVPGTKSCVTRQWPLPREQCDVIDAFFRAKHEAGMVRESKSPHSTPTFCVRKS
NGKWRIVHAFKKLNAATIPTQTPIPRKDVLQNNMVGCTAYSALDLVDGYYQLLMRASDIP
LTAVSTPSGMLWE
Download sequence
Identical sequences H3GYR8
jgi|Phyra1_1|82870|fgenesh1_pg.C_scaffold_79000014 164328.JGI82870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]