SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI82897 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI82897
Domain Number 1 Region: 123-263
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0000000353
Family Lambda integrase-like, catalytic core 0.035
Further Details:      
 
Weak hits

Sequence:  164328.JGI82897
Domain Number - Region: 276-303
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00366
Family Retrovirus zinc finger-like domains 0.0092
Further Details:      
 
Domain Number - Region: 857-916
Classification Level Classification E-value
Superfamily Acid proteases 0.0534
Family Pepsin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI82897
Sequence length 1058
Comment (Phytophthora ramorum)
Sequence
MSLIDLAPANTKRARENASRTFLKFLADEEVAWDYLETCMKRDNAAQVLEAVVDKFGIYL
AFKEGRKGQLLARHSVMQYFRQVKSWLLEQFPQHRALVDKNLLKKGQMLERHCMKRETGA
FVKKAPACTKTALKKMMEYLYSTAVTAADYQDAALVALMWFLFGRASDLTMLRKANLSVG
SGKIFFARFIRIKTSEEQDSAGEAGDGTSTDAAPGVHSYVNRVLDRIAEKAGVVEQLTSN
SFRRGGAQHANGAGLRAQWIFDRSAWNMTATNKAFAQSPGRKPMPCFMCQSLDHLVAQCP
VLASVKELATQGAVIAWEDLEKEDLAASKTNEGVNCYENLPELREKMDNENNEFEEIMPA
DLMKNESEKERIKSSAEDATEVTRIGPREEGLMKPEGSGIETLDGAAEALGTLREDASIA
ITERLVAVAKEGKESMNNGEVRVDETVPKEQEPITVKVIPKYSRLFTTAELEALEKGRTS
AAAVEKEEYEKELEEKLFALDEIELKRRVKKNAEQQKEPTLDDVSTLLSIPVETLARTKE
ASPGALSSPEYWLEWYKSTLATSKEAKRANRDFKTVSETYVAVVDPGRATSSDCQDVGGG
SDVVADEVLRAGRSGRRRKSPPVTESDVALNILVDVAGLEPRSKTYPTEVDEYNPERLPP
PLRALVRIVVYELVREDERPVTPMCSSCRSKVLSHQHGRSEIGDPTLFQDDSRGVRARAI
VVRLASQIQEEALLAVLERVRQEYEREADLMRIKRRERGSRCHRTICAPRASSRTKSVMF
DCTSLFARHSEAFGAYATSGESADDVNPYVYTVRDSNYRSRRRKPGLREMKAGSESDEVL
ADSEQLISEGKRIIGSVGGAEAVSAGYIDYLPYAILGTDTLKAYRAVIDLENNTMTLKDT
NEVFLLGSPRVEETHYSRLSVPELDDTVKIARTLCTVQGEKVIIEMCNASLENVVVKKGT
LLAAVSVVPSTAFGSRLAGRKPVEPCSPSNSSWIDTVLGTVATADDPSSESMPGLKKANT
IDLEIDFGDSKMSAEQRSLFKSLLESYKDMFVADAWPY
Download sequence
Identical sequences H3GYU0
jgi|Phyra1_1|82897|fgenesh1_pg.C_scaffold_79000041 164328.JGI82897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]