SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI83131 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI83131
Domain Number - Region: 596-618
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000837
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI83131
Sequence length 633
Comment (Phytophthora ramorum)
Sequence
MSPDAPGVTVTSSDGRELTLRRGLTFLDRPSATAFFQDFAKAQGKRLVINKKKSGGAQYE
YVCASRMPPCNFRIKLLKSRSAQSSHFFVSSFFAQHAADCAGAPKLTVRQAAAALLGDAQ
ASSSTATVASVKELQERLQQTSGETISARKAYRVRDRILRLAAGQFAKGFQKLESLLTGF
QSKNHGTHVNFETDAMSGMFRRAFLAHPFAAGYQQSLQPIFGLDTAPLVSMNYRGQVFVL
HAKDGNDELVPLCVAVAPQADADNWSWFLMHCQQAQVDFSRVVVVADRTRGLLTAAETLG
MPLRQCTQHIIANLKAMVKNLATVQVEDLVKRAQAADSEAEFNSCLSMIGLTCPAAESYL
RGLDPRSWTLFCVAQQVKLYGRNTTLFSAEDNKALLCLAPYDLMQHYMEKFMTLAYSQSV
HAKKWAHEGKLFTAYADTLLAEQREAANFQVVQPSDDGVVFVTESRSFPPRRYRVDLNQC
VCSCAYLFQMGVPCRHFLAGLAFFKRSNEEADFVDTCYSVSTFAAQYNSQRTGSIELLLD
SELEENHSVRAPIVARKRGRPKSNPSPTTTDVLITPAVASAILNGDTSLLVDNETSRKRR
CSSCGQVGHSKRTCNQIPPAPSMVSEVGRSRMV
Download sequence
Identical sequences H3GZC6
jgi|Phyra1_1|83131|fgenesh1_pg.C_scaffold_83000027 164328.JGI83131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]