SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI83195 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI83195
Domain Number 1 Region: 249-371
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.17e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.000033
Further Details:      
 
Domain Number 2 Region: 363-412
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000256
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI83195
Sequence length 602
Comment (Phytophthora ramorum)
Sequence
MATVDGEKPQDEYHYEEQQEKEAMMKSYHHPMKQWFRQRPQLKTKYGAFPLFWQELKTWE
PYREVLKAYIKFTEHGEDVEPSEKKNEEPADKEKQGGTTTEKREDAPQATEEKPKKRRKS
RWGDPVEPTDDGSGEKRRKKSRWAPAPSASSTMAGLLTQKQQQTVVLRSQLDNINLKLKT
VAMDAALIEKDPNRSPSPPPQYDSNGKRTNTREVRMRAALEKRRCETIDQLVKANPLFRP
PADYTRQKLNRKIYIPIKDFPGYNFIGLIIGPRGNTQKRMEQETNCKIAIRGKGSVKEGS
KGKKMNADENDDLHVLITGDNEENLERAAKEVQSLLVPVDDTKNSHKQKQLRELALINGT
LRDDDYCHICGEKGHRQWECPNRDAHRTFKAVNVKCAICGDSSHPTRDCTQKGKSAEENA
AIDKEYQSFMQQLGEAPAMKEKVPASASQPSTTSAVSAPWLQPAKTSSAGSAQPWMMQQS
VGAPGTAGAPGVQPSGVPAVGSTPATAFPPPVAPAGGYDYQAQGQEWGAAQQGWNGGYNS
YYGSWDQSAQGAEYQAYGQQSAPGADYQAYGHYATPAGGASGAPGADGADQYQYPPYGNP
PQ
Download sequence
Identical sequences H3GZH0
jgi|Phyra1_1|83195|fgenesh1_pg.C_scaffold_84000021 164328.JGI83195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]