SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI83229 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI83229
Domain Number 1 Region: 343-420
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000137
Family Retroviral integrase, catalytic domain 0.042
Further Details:      
 
Domain Number 2 Region: 66-93
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000858
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI83229
Sequence length 433
Comment (Phytophthora ramorum)
Sequence
MEDEDVAICLLRSLPKSYENVVLNLEMSSAELRSQDVVKVLTNEHIKRQGEKTATVKTED
AAKAFNTDRESRQCTYCGKLGHTIDKCWTKQKDENRGPRRGGNGNGRGRGANNAQWRNDD
ASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSGATHHICNDKAKFAHLIERNEGEL
SVADGNKAAIMGVGTIVERVVLPNGDERDIEIKNALYVPSMSKNLLSVPQINKSGLFQVV
FDGTQMRVAHKASKQVVAAANLVDGLYWLQTPQRSANAATSGKTIDLHARMGHAPVEVLR
KMVDNDMIKDAKAPSKSSGPSVCRGCQQGKMVQKPFPSNRDKRRYDTFELLHFDICGPVE
EESLGGSKYLLLIVDEASGCMKGFCLRAKSESEDCIKTYVTKVQTQFGKKVKFVRHDGAP
VRPDCRLSEGVLR
Download sequence
Identical sequences H3GZJ3
164328.JGI83229 jgi|Phyra1_1|83229|fgenesh1_pg.C_scaffold_85000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]