SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI83410 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI83410
Domain Number 1 Region: 113-143
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000196
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI83410
Sequence length 716
Comment (Phytophthora ramorum)
Sequence
MENFSCLRWRQDISSFFKWISHSTSQLKTLAEQLDAVGAPVSEDDLVITLLGSLSESYQF
LITALESRADSLSWELVTSRLLHEDMKRKEQGGGGVDGAAHGQGQAFMTRDNKRKGRPVK
KTGACHNCGKQGHWIAECPSRVQNDAERYRSQRANVAQDEEDSGDYLFSVGRTSSTAKPS
DMWLIDSGATQHMTSSNKYMRNYKTMAPVDVHLADDGVVQAVGTGDIVMSMKMPRGMKKG
VLTNVWHIPKLSRNLFSVGRFTKDVGPVTFESDGCFADKKGLKWQLGAREGKGLFKLCMT
PMMPDEANAASSKDRQGDTTSYLWHLRLGHIGHGGLDAIVKKSYGVVSCRNTQKISLPNG
MSPTNNTRFPRESQSTPTRFESVRKMGGIFGRDVLRGLASVTPAEQVERVNAFDTYEREL
IAHVQGNLQASVAEPKPLWEPLRLYTAEVRVAAPLDRALMARRSPLLNRATAAALHALDA
SGEDASGTPSAASGSAGASVTVPRSPAATPMAAGEGAEGSSPPTPPSSPGSSPVLAYLLG
ATPTVVSTPPGSPATHSVSVGCQTDPTDGGLPRSAQAEPSEPSSIERQLLQLGHLVVGVA
RQRPRRVDSVLDSRLESATDLGEILSAAVAPARLSLAESEEIISLRDEIARLQAQCADSE
DRLHAEVQQREKIEVFCTQATSDSNQAMDALRQLRQDHACRLAPRLPRLRRRLLSD
Download sequence
Identical sequences H3GZY1
164328.JGI83410 jgi|Phyra1_1|83410|fgenesh1_pg.C_scaffold_87000071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]