SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI83413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI83413
Domain Number 1 Region: 172-208
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000733
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI83413
Sequence length 221
Comment (Phytophthora ramorum)
Sequence
MADRSKVPSHLPKFTGKRGKDVREWLFQVENACRINGIAIEDASTRLPGIAGSAMEKPAS
GWFLHWSSTIRNEEHTWGIFREHVLQHFEASNYQSVLRERLQRLKQTADIETYNGDYSAL
IFRVEGMSALDQVLNYANGLKPRTRSYVKLENPETLSDAMDLAVKYEGKPFRGKGRFKPR
AKSESKETRTCYFCKNPGHIKADCYAWKYEQAKQGNDKPRQ
Download sequence
Identical sequences H3GZY4
164328.JGI83413 jgi|Phyra1_1|83413|fgenesh1_pg.C_scaffold_88000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]