SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI83670 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI83670
Domain Number 1 Region: 670-829
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.26e-33
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Weak hits

Sequence:  164328.JGI83670
Domain Number - Region: 254-359
Classification Level Classification E-value
Superfamily Acid proteases 0.000675
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 
Domain Number - Region: 444-513
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0385
Family Reverse transcriptase 0.036
Further Details:      
 
Domain Number - Region: 194-223
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0698
Family Retrovirus zinc finger-like domains 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI83670
Sequence length 908
Comment (Phytophthora ramorum)
Sequence
MPGFTVDFDGDVEMSIPQPIFEVIRPPELSSWEHAALIEWHREWERYVDKIRHRCAVTGE
TFENVVATVRGSVKPKTLKNMDTYVLKKHVASVTDEDIMAAVQARCRTLKNEFVPDVTSL
FRQQLKMELSIDDCDARIFRYYEDFNGIVEDNGLQKLIGAGSEAEAATRHPVLKAQITRL
IELERRDCGALVVRPSRSPPHDGCLVCKGAHWLKDCPAATDAQREEAKKRFREAKEQRAG
QLRSKAARYVVPDATVRINGLLEVPYSPDTGADKSVIPQAFLDALRSVQLTLAVTPLNMP
VDAKMADGRLVRCDNEVLLDLEPFTIAGPVSMRAVTCVVLAGEGDEFLLGCDALKTLGID
VQDQHAQLAGFSLLGAEDDEFPVGDELPGSEELPEDGTALDHLVAQAVANGLTAEHARPT
DCKTPFLIIRGLSGYSIIVTQVIDWNPTLPVAKQHHELIICKGGTFKHNELNWTIVEKKA
YPIVKACHDLEYLLLRPKGFRLYCDHRWAMRLCGLHYVIEHIAGEDNVWTDIISRWHTRE
IVRVAAVQTRSRHVTPLAAMSPLRPLSDAEFVFPTMDDIRVAQDAAGRERSRLRVALDEV
DGVLTAEGRPWITNGAKELLARIFVVAHTGAQGHRGQESMKALLQQRFWIARVVEKFIEV
RPRIIPRPYGPTIVATRRNEALHWDFLFLGSGYGDTAYLLVVKDELTQYCELIPCATPTS
FAAAEALSIWCARYGIPEMLQPDQGTHFRNEVVKHLCARLKTEQVFTPVYSPWLNGTFER
LNKDILQVVRVLLMECNINVHEWPYLLPALQANLNHTPVQSLGGHSPVELFTGLPSSSAL
DAIVDHRADADPVLIADFECVDEQLELLRNSLHGIHKEVLDEKERRQLQDMAAHKGSTAN
FDTGNFVL
Download sequence
Identical sequences H3H0I4
164328.JGI83670 jgi|Phyra1_1|83670|fgenesh1_pg.C_scaffold_93000025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]