SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI84016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI84016
Domain Number 1 Region: 266-291
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000126
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI84016
Sequence length 321
Comment (Phytophthora ramorum)
Sequence
MERSEFPHLNDSQFESVGKMGGIFGRDVLRGLASVTPAEQVERVHAFDTYDRELIAHVQG
NLQASVAEPKPVQPKSLRLAVPAFEGKEGENLHFWIREVEVAMRAGLISDQGLRVAFALS
NLSGRAKNWAYTLETTSPGCFASWEHLCERLRAAFLPANDAFRQRSRFLACKQGKRELYE
YVQEMRTLASSLVGNPLPEDVKTTVFMDGLKIGPARTQLFRVHASTMEEAIKIALQEEYS
HKQAGTPVVAQLVVANNEPEPMDLSSVELGSVRCYKCGGLGHYQRVCPSPGVGKNPSLKP
RGPNGRWRKPRPGGRGNSGHK
Download sequence
Identical sequences H3H1B1
164328.JGI84016 jgi|Phyra1_1|84016|fgenesh1_pg.C_scaffold_101000026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]