SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI84275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI84275
Domain Number - Region: 267-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00942
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI84275
Sequence length 377
Comment (Phytophthora ramorum)
Sequence
MQTTSGSARLFEPIVPPEIKSISHEALTQWKKERRDYEAKLRARCHVTGEVYEAVALPII
ESFDPDLLDTFCELRLNMASVDVTEGMLIAEISHVVSNVNNDTLPDIKTLFKVKLRMNMT
ESDVDARVLDYFNHFGKIVRKNGFVNCFEGNYGIKEKCKRLVASLHPATLNDEVKQCVCY
THKPAASNPRLLIVEKAKEHERQCQRMKKRDTIGRDQDVKKMPKSKDKKRAWNNKRAVMT
GAERKPVTVTPMARADRRPSSSSNSLPPSPCPKCKKMHWLSDCTKATENEKAELRVRMRE
TYAAKKARMKRLGVFLPGTDGMVTLNGVLELPYCADSGSDHTGSAAHIGSSYRLWIQASN
LKNLTSLCGTKHLVLCK
Download sequence
Identical sequences H3H1U5
164328.JGI84275 jgi|Phyra1_1|84275|fgenesh1_pg.C_scaffold_108000005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]