SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI84461 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI84461
Domain Number - Region: 444-487
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000222
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI84461
Sequence length 544
Comment (Phytophthora ramorum)
Sequence
MTEVAAAQLLATVQRPFPQNQEKHVKRDNGAEDAAAAQSVQATQGATTRTFVSRAQSASR
TQGTSRAQGASSAEQTPHSGSRRSDDKRKPPKKEKRQDASPPADPDPSGDSSSEDSSSGE
SDYDFGQNADSNLTAAKTPEGTTLLTFRPYINSHTLSEFDTKAAIRERVHWWEQFANLAA
QGAWSNKMRIQELKLKLSGAARDWFNQLPKHTQRDWKELATAFRKKYCKARASYSERYYT
MEMRSSESALDFFYRLNSAAGKADIDFRKSTKRLEKHIRRFITKLKETRLKTSLQGQRFK
SISDLEYALEQDEEVWTQNERDAATSRNRDFRAGNLPNPGRPRPKRFERAYLTQNADFGV
KMSEYPEELPRMQDAVEESGVSAQGVDSGSQDNRDDGGALNAGPSGAEWTQTLTNEVYRV
MDNMGWRPPGHAPHGNPVPNSGRRENPNWDKYCEKCHKWGHPEESCWKDIKCDRCQELGH
PTHMCRAQPCDNCGKLHQGKPCEDWKALEDLKKLARQGALKDLPSHILDKLLDGEASTGK
PLNL
Download sequence
Identical sequences H3H289
164328.JGI84461 jgi|Phyra1_1|84461|fgenesh1_pg.C_scaffold_113000040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]