SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI84592 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI84592
Domain Number 1 Region: 638-992
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.11e-101
Family Reverse transcriptase 0.00047
Further Details:      
 
Domain Number 2 Region: 1545-1626
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000402
Family Chromo domain 0.01
Further Details:      
 
Weak hits

Sequence:  164328.JGI84592
Domain Number - Region: 212-231
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00356
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 
Domain Number - Region: 274-324
Classification Level Classification E-value
Superfamily Acid proteases 0.075
Family Retroviral protease (retropepsin) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI84592
Sequence length 1679
Comment (Phytophthora ramorum)
Sequence
METSSYSGEGPDHLPLNRWFREIDIAIASRLIEAPSAKVNFLLSRLSGKAKEWALGKLVV
DQYAFPTLEALQSDLRLAFEPPQDESRVRATFFALKQGKMAMRDYVQRTRHLASCIVTKP
IDMASQVHVFVFGMCEGMTRYCLTRAEPATLEEAFALALREDYLVTSSYTKTMPAQTRVS
VPEPMEIDATDASQNRRWSSSGRGRGGHNDLSLNCFRCGKPDHRAAVCRAPAPILAHMKH
VTPDERIPAAQPKNGRGHGDSRLIIVSLYVAGARRPLRALLDSGATNNFFRTSCLSILPA
GVPVRDVPGDVVVKLADGKPFRVARREVSLPYTFDGFCSNDNFIVLEMNYAFDCILVVDG
TSTTHVVRRASDGPLCTTCAVLLTDDDSVEHPSGYGRARRAVEHPRLPYDDEAVEQGLPY
AFDTVEQGLPYDFEAVEQGLPRVYETVEQGLPYDFEAVEQGLSRLEEGEVSSGDSETSVL
SRGSRRTKTSRRSRRRLKPRRSPVELTTPPIESVCAVEYVGGVPNHARMIKVASPPRDAK
SITDLPGLSWKSFLRDLKAGDIEQVCLITDANPVSDEMNAIAHNDTSSRPKSAEPKSARE
ERFAAQSWKSLKASGNPVYETAREFAGQDPCGAASGSRIKAIDDFFEGRRQTGHVRESIS
PHSSPTFCVKKSTGGWRIVHAFNKLNDATIPTQTPIPRKDIVLDSMSGSVIYSAIDLTDG
FYQILIRESDVPITAVSTPSGMLWEWFVMLQGLKNAPAAFNRMVSHALRPLRDFAPSYFD
DIFVHSHAEEGLSAVDVHLRHLRQVFQVMRENKLYANLKKCVFCAPEIPVLGCYGYAGLI
QPLSSLLKKDATWSWRPEHQVAFDSVKRSLASAPILMLPDDAKPFHVVCDASDFAIGCAL
MKFDNEGCERVVSYQSRQMKPAERNYPVHDKELLAMRHALIKFRVYLLGEQTFAVYTDHA
SLRTAMKSPHLSQRMARWLSFFAEYNFVVHYKPGKNNILADALSRRPDYDPRETRGRQVI
DEDEVDEDHCAMCLTSGVNLMHVTPEMPLREENAVAYNDDAVYAAILAHLLSPSDKTLRA
LPNNTRSQIDRYQLDGDLLTYSIDRFDAPRIVIPNDDDLRARIIHEFHDSPVGGHLGRET
TFAAVSRDFYWPHMYKWVRKWVESLPASGNEAAHVNGGASGDGCWSSFLPLAEFALNNAE
HASTGLTPFFVNNARHPRVPALLAVGHPTMPRGSTLGGEGNDGAGMVSTDGTPPPPAPLS
SAAHQSVTLNAVTRSKSRRTLATPNNAASSLADWTARTLINPGPATDPVAANYAPKPPAR
PVDDAAVSDFVLQRQSVTRFVRDALQEAVYKQKENADKRERKNVATFTTGDRVLLSTDGI
RSSAVTNLGASKLAPRFIGPFRVTKVIGDAYTLDIPSSLRLHPTFYVGRLKKYHAATIPS
APEHPPAQHEQDVPPDVRALPSSHPSHPSARADVLPSAAPRTRALPAPASVAAVPHSFGE
QPLLHPPPDEPAPPPPQHQAERPAPNSLPRPRHPGRPGRELYRREGPPPIVDSAGDIRWI
VDRIVEHEDPPRTYAHTRTSTRSKHAVPTARRYRVRWLGFPPDEDTWEPRAALLRDVPDV
AREYENAIVNENDATAGPAVNENDAADGPAANENANAGVHVPVAAEDSAEYPRGVRRRD
Download sequence
Identical sequences H3H2I4
jgi|Phyra1_1|84592|fgenesh1_pg.C_scaffold_117000017 164328.JGI84592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]