SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI84617 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI84617
Domain Number - Region: 1011-1051
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00549
Family Retrovirus zinc finger-like domains 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI84617
Sequence length 1098
Comment (Phytophthora ramorum)
Sequence
MEEGSAMDLEEKPHPPPQVPSGTPADHDANRDPPDEGSTVKTEGPSSKTTPPASLATSKK
KSKTSRKKLKAPESEAEDQEDRNTWTDEQLESAFFYKDLYKFLHEDPVMKIVRPKPIGEL
QGPVKAPKEVTSQLEAVKLLMHMLKEAGIVLGSFDANELFDVELPVIRESTLNLFAKLTP
LVGSVVPVQRARPTPTRSQTGSSQYASATSEAGSDSSIELQRMTLGPAGATMLQSRKERS
EAKPTVIASSDPVQAPPERMQSFFNAAMERFLKEQQATVTPPAAVRNSPTGAQDVDMESV
GSNRLDQSHPTPDGEKCLVFGDLLTGPARNWYRQLSRTTRGDWKGLSRNFQTQYCGRGVS
VARQYYHARKRSDESPLEYLHRLNVAGLRAQLSIKDGSIEVRREHVDHFIETLDDRDLAK
QLALLRIPDADTLEETLRSRQRAKARQGKTVYGSIKPKQKPPTGITPSANTRAVRAIRAT
VNSSDSELETSGSEGEGDLRKAPESEAEDQEDRNTWTDEQLESAFFYKDLYKFLHEDPVM
KIVRPKPIGELQGPVKAPKEVTSQLEAVKLLMHMLKEAGIVLGSFDANELFDVELPVIRE
STLNLFAKLTPLVGSVVPVQRARPTPTRSQTGSSQYASATSEAGSDSSIELQRMTLGPAG
ATMLQSRKERSEAKPTVIASSDPVQAPPERMQSFFNAAMERFLKEQQATVTPPAPLGTVQ
PELKTWTWIASAGATGGGTLSATRIRVSAISELKEFSGKDNDEDRARSWFGKLKSAFVRD
QAPDGEKCLVFGDLLTGPARNWYRQLSRTTRGNWKSLSKNFQTQYCGRGVSVARQYYHAR
KRSDESPLEYLHRLNVAGLRAQLSIKDESIEVRREHVDHFIETLDDRDLASQLALLRIPD
ADTLEETLRSRQRAKARQGKTVYGSIKPKQKPPTGITPSANTRAVRAIRATVNLSDSELE
TSGSEGEGDLRKVYFAATPDQPTRSRSDQDQRRPSRDSNDRRLDLPAGPPEGEVPRKPCS
HCGSSKHTDLGCWKRLTCEKCGKKGHPTDRCLIVCKACGEIHGAGECPMEEFYNLIRQWY
NPNKHGGMLPQAAEKMLN
Download sequence
Identical sequences H3H2K1
jgi|Phyra1_1|84617|fgenesh1_pg.C_scaffold_118000024 164328.JGI84617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]