SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI84816 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI84816
Domain Number 1 Region: 787-966
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.11e-51
Family Reverse transcriptase 0.00019
Further Details:      
 
Weak hits

Sequence:  164328.JGI84816
Domain Number - Region: 277-299
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0419
Family Retrovirus zinc finger-like domains 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI84816
Sequence length 968
Comment (Phytophthora ramorum)
Sequence
MSLLGPEGVAHLASQGPDAINARLEAFSSYENALLEHLQQKMTAVTASTTPKPASDGAPR
AKPLMVSVKTFEGKEGENLLLWIREVEMAMASAILQTEQQRVALAVSKLGGRAREWALTC
GTSVHSAFPSWEQLKLQLSRVFSPPNQAYRVRSRFLATRQGKKELVDFVQELRTLIAGMA
ADPLPEAVTVTIFMEGLRTGVARTEVFRVHPTCFEEAVSVALNAEFNFKSARAGWGTSQT
NSSGAAGPSGGPEPMDLSHAEDEEAELLAAEQRIGIRRCFVCGSTQHLRPGCPLRKQRQA
PASRSPASYQKPGAGRPTGEELSSVEPQQGGQQGLAPKSTVLFNTERVCKPGLLVVEATV
KGFDKPWTILIDSGASGNYARRSTMEGSRQYAEALVARTSDITTVRLATGTRVTGPKVPV
NLGVKFLDFDSVERCLVLDLDSRYDLILDMAWLERHEPWIDWRSKTLGATRLPPGEALAS
HEPTSARKQKRYWREHWTETVNVLDIGVSELIDTHDVVDKSPEGAVRGAARNPLSGPRCD
NEPSLQAADGMVGRKPRHRGHSPDDARGAARYPLSGERRDGGESLRANDGAVGHEPRHPG
PSPNDACGVAHNPLGGDRELCSSSPDVEFDVDAPMNQQEVETPEDTFGVNMQASPRRMVS
ARRRQRRRVAAARRKASVMIQQVSGVVDSEQLYTLVNGVTGEVAGDVSLEAVPAADALLE
LDEMSIAEFGEALKAGELAEVAIIRPEDELNSSSLMDETVLEDTKQALSARSGSAILKNP
SDPYYPLVKKYQDVVSNDPPSDLPPDRGVCHEIDLVPGTKYCVTRQWPLPREQCDVIDAF
FRAKHEAGMVRESKSPHSTPTFCVRKSNGKWRIVHAFNKLNAATIPAQTPIPRKDVLQNN
MVGCTAYSALDLVDGYYQLLMRASDIPLTAVSTPSGMLWEWLVMPQGLSNAPATFNRLVT
QFLGPHRA
Download sequence
Identical sequences H3H2Z6
jgi|Phyra1_1|84816|fgenesh1_pg.C_scaffold_126000001 164328.JGI84816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]