SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI84819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI84819
Domain Number 1 Region: 448-611
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.45e-31
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Weak hits

Sequence:  164328.JGI84819
Domain Number - Region: 210-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000193
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI84819
Sequence length 916
Comment (Phytophthora ramorum)
Sequence
MSSAHDASTKVSIDKFNGDNYATWNRYMRGVFLTKSVWHVVNRETTLSFTDSRPKDEYVK
SSNIAFGLMFLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSE
GGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYENVVLNLEMSSAELRSQD
VVKVPTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCWTKQKDENR
GPRRGGNGNGRGRGRGANNAHGATHHICNDKAKFAHLIERNEGKLSVADGNKAAIMGVGT
IVERVVLPNGDERDIEIKNALYVLSMSKNLLSVPQINKSGLFQVVFDGTQMRVVHKASKQ
VVAAANLMDGLYWLQTPQRSANAATSGKTLDLHARMGHAPVEVLRKMIDNDMIKDAKAPS
KSSGPSVCRGCQQGEMVQKPFPSNRDKRRYDTFELLHFDICGPMEEESLGGSKYLLLIVD
EASGCMKGFCLHAKSESEDCIKTYVTKVQTQFGKKVKFVRHDGAREFATNSLKAFYKVEG
IEQQTTVPYAHQTNGTAERAIRTIVTIGRSMLHHAKLDKCFWAEAAMTAIYVKNRLPSPK
VEHKTPFEIVYNFKPSVKHMRNPKARAGLFLGYEEVSKAYRLYDIEAGQVVVSRDVNFDE
SVFGLSAHTSDEDVDDAALDLDALDLDDNDGPRQTSFKQAGKRKSRPSGDDDTARRSRPV
RHRAVLEEASAPDVSSSRRAEPDEEEKSGDQDEDDDSTPPVFWRASANAVEAAADLSEPT
TFQEAVNGPDQVHWRKAIRAELKSMRLRGVFRAAKLPTGQRAIGTKWVFKIKRKADGSIE
KYKARLVAKGFKQKYGIDYTETFSPVVKYVTLRMIIAIAKYFGWPLDQLDVVTAFLYGVM
KEVASNWMVASTAWNW
Download sequence
Identical sequences H3H2Z9
jgi|Phyra1_1|84819|fgenesh1_pg.C_scaffold_126000004 164328.JGI84819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]