SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI84898 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI84898
Domain Number 1 Region: 699-1091
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.67e-102
Family Reverse transcriptase 0.00058
Further Details:      
 
Domain Number 2 Region: 261-288
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000192
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Domain Number 3 Region: 335-435
Classification Level Classification E-value
Superfamily Acid proteases 0.0000113
Family Retroviral protease (retropepsin) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI84898
Sequence length 1298
Comment (Phytophthora ramorum)
Sequence
MVSLLGEAAFAGFPNVPAEQQRSRVERFDKYESSLIAHMSTAAQEAARTAMRAEAQSVTQ
ANPSGPASYAARQGTTKPVRMSVPTFDGKEADSLVFWIREIEIALSAGQIYESRAQVAFA
LSNLGGRARAWAMAREREPRGRFQAPPNASGPPPSYSPYGSQQQQQQQQYGDMGPRVGYD
RQYPQQYPPQQGLGGPFMPGKRKVDAIPSLRTLRQPKPFNDAVHIAMLEDHCVRSAQGYT
GRAEATEGPTPMEISSAESARPQRNQRTSGRCFGCNQLGHFCRNCPTNLWKAGRGKAAPL
LNVIESAVSENGDSQYARDALLGDVAPPRASVKGYDEPLKFLIDSGASYNFATKASVVRN
SALYASALEASKRNTNVSVRLATGSIVSTRKVRLSLNVNFDDFNSVEPFIVLDMDDRYDL
ILGMPWLAKHEPWIDWRSRTIGASHKPLADRALAGHVPSSSRDGFVHEHRVPRGERHFAG
TSEVLGLPSAMSTASSTSSRAHEPSVDVGEDMEFLCAPQDEAHETLKNENVAFAHGAGGI
QSVRAAAAHAGAVARAGARARTCGRAETPTSEDAKAGTSTPGLRLGVVRRNADPSDRVVG
PTVLDVLTGEYKDGGELAILLAVADLLELEELSYVEFLDSLKAGELEEMVLIRRELDSIE
LNTSSVMDPEVLENERSSSRQKRYVAAILKDPSDPYYPLLKEFSDVVSDNPPSVLPPDRG
VRHEIDLVPVTKSCTTRQWPLPKEQVDVIDAFFAAKYAAGMWRMIHAFNKLNAATIPAST
PIPRKDVLQNNVVGCTIFSALDMVDGYYQLLMRESDVPLTAVSTPSGMLWEWLVMPQRLS
NAPATFNRLVTQHVRPMRQFVQTYFDHSFVPSRTSGVYLGAEEIPFLGCFLGKDGVRADP
EKICAIAQWPVPVSQKDLRKWLGLANYLHKYSANYAEMARPLTNLLKKKAEWSCDDEAQQ
AFESIKSSLQSAPILALPDDDRPFSVVCDASDFAISCALLQVEADGRERVVSFQSRQLKA
AEKNYPVHDKELLAMKYALVTFQVLLLGSKPFVIYTDYASLRTATSSPHLSQRMARWLSF
FAEYNFTVEYKPGKPNVLADALSRRPDYELAHVAYLESPLYELLREAYAEDVDLADLVTS
LKVPETGVQLTARQRLRLHRYSLADDLLYYQVDESDEPRIVVPNDENLRHRVLYEAHDTP
LSGHLGREKTYTSVARNFWWPDMYKWVRTYVQTCETCQRVKHAPSSSAPLMRLLMPADCW
RSVSMDFIFELPADTRGHTGILVFVCRLSKMVRLVAVK
Download sequence
Identical sequences H3H363
164328.JGI84898 jgi|Phyra1_1|84898|fgenesh1_pg.C_scaffold_129000005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]