SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85034 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI85034
Domain Number - Region: 248-263
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00185
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85034
Sequence length 301
Comment (Phytophthora ramorum)
Sequence
MERIRVRSKDGRHLWEGCPPRLGVLDGSRASRTRAFDTYERELIAHVQRNLEASVAEPKP
VQPKPLRLAVPAFEGKEGENLHFWIREVEIAMRAGLISDQGLRIAFALSNLSGRAKNWAY
TLETTSPECLASWEQLCERLRAAFLPANDGFRQRSRFLACKQGKRELYEYPEDVKTTVFT
DGLKVGPVRTQLFRVHASTMEEAIKIALQEEYSHKQAGTPVVAQLVVANNEPEAMDLSSA
ELGSVHRYKCGRLGHYQRVCPSTGVGKSNPEGLTVADASRGQVAEGTPATSNGGFPRGGG
S
Download sequence
Identical sequences H3H3F9
jgi|Phyra1_1|85034|fgenesh1_pg.C_scaffold_135000001 164328.JGI85034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]