SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85040 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85040
Domain Number 1 Region: 248-286
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000275
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 
Weak hits

Sequence:  164328.JGI85040
Domain Number - Region: 2-32
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00121
Family Retroviral integrase, catalytic domain 0.025
Further Details:      
 
Domain Number - Region: 577-599
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.0918
Family Hevein-like agglutinin (lectin) domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85040
Sequence length 734
Comment (Phytophthora ramorum)
Sequence
MLSMSTADHPQTDGQTERVNRVLVDTMKSYAHSFLLEGAACACLVAQLPCPSTDTKFKVE
PFDGSNYSLWSYKMKMYLMSKGLWEAVCGEAGSTAKEQQAHAAIVLNLNDSQLMHVVTST
TAKEAWDTLKKFHKTQDMANRLWLKEKFSAFKFTASSVGKHVTELEKLVMEMKNAGCEPT
EEDVCATMLRSLPSSYEALVQAFRMSVSEFKLADLVSKLIAEEVRQKDSNRIEEATALLA
GKGSGKQQQKKKNPRGMRKKGPFGKCFNCGKPGHYARDCRSEANGFDAGDVQLPVPPKMR
FGDNLIEAIDGLSNIAAGTVPDDYLKEMGINGWSDLQTHGPYDYLMEPYEPRPPNAMATD
YPNLYTGESGPTARALEAAASLSGAFFYFMQPELWEDIAEETNNYFEEKLEERVQVQYSR
QVAREKKHPEFKRQTTERIHTELLKMKAVTPRDLCVFVGLLIARSIAPNKEKLAHHWKTT
NEGAIPRGYFGQVMVRDRFMHISRNLHFSCNDDERAAKDRAWKLRPVIDALKDRFAAGFM
PPATMAFDEAMLPSRSTFNKMRVYLKDKPHKWGTKLFMLCCSTTAYCIRFEVYCGKKERG
GQGRSTDFKSGLSIQLIPKKKKGEKQKPPKIPKNRPASIERGTFIVADALQIPGMRLLRW
WDTRAVHMLSTGGSVETNRIVRREKRTGEQTEVACPRIVKDYQTFMGGVDVHDQLRLQRV
YSARAPEDSADQEA
Download sequence
Identical sequences H3H3G5
164328.JGI85040 jgi|Phyra1_1|85040|fgenesh1_pg.C_scaffold_135000007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]