SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85043
Domain Number 1 Region: 535-842
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.67e-36
Family Reverse transcriptase 0.003
Further Details:      
 
Domain Number 2 Region: 996-1153
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-30
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Weak hits

Sequence:  164328.JGI85043
Domain Number - Region: 306-338
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000706
Family Retrovirus zinc finger-like domains 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85043
Sequence length 1292
Comment (Phytophthora ramorum)
Sequence
MEHEDNQGVRSAEALEDPDVDQLAERVAAMQLESAASRTPRSPGLRLQISNPFEQVSAEE
ADEAMATASPYAGGFKAGLCRTFMRQYETYMGAINALQTQWGRVFAMPVGACIDSRTKRM
VAQYEFNQPPHLISEDQMMNLQADLEAILDKFNLTDVAFEHEQRRIVKYLANALTPASFK
AVIVMKLTLHENKRYKNEVVPFCSWVTKLMREFMNWEHAAQAPASARSMEQNHQQQRSSN
RGNTGGRGASGDRGQGGGRGQGVGSGGGDRSGANDNRGGHDGRAGGDVARTLQARGSTGA
RPAGASDEDTSGRPSRGACLKCRSMDHQVRDCPSCQPGEATRLLQALRERREAARDIFAR
RFAVVEPEESPMQQEDADDDRGTVAAEVDGQAVTALLLGSGADTSLVTSGVLEELRSSGK
DVPVRMVNGVRLNPVCGHEVQMKRQVTFKEVVLTTSAGPLMLRNLACYVEEDNASLVLTV
GRPVMKILGYSTDKLLAKAKDSRSEWEVDEIVLCLEKKVEVATKMGLTLDGRAAQPDAQP
VRAQPRRYSPNDPSLLEHGFVFKNHRSRWASAPRIVRKREQNADPTADPRMTIDTRGVNE
RTDPMPWTMPVLEVVLGDLEGAKVFFVLDWFRGYWQLPLHPDSQELYSFVTHRGIYTPIR
RCAAYDLKLHAKKCQFFATERVGSHKKTQLAKVRLEDIGSGDQEITGFEDVRTALLGMVP
LAHPSPTADVCLYTDASQDFWGAVVTQLESHEVSLPLDQQNHRPLAFLSGRFVGAAVRWP
TIEKEAPKGFRLYTDHRNLVYIFDPYATDGTMAKYQADKLQRWALSLLSFRYVIEHVPGE
ANVWGYLLSRWGAGQDQPADRAGVRVARLAVVERVSPIEEPDFVWPTEAQIKELQQHAQD
AGADLQGGQWSDRLQLMVTPPGQVCIPADSAEMQQRLCIIAHAGAGGHRGAKTTAKALSE
LFFWPTLTKDVAVFVDGCLHCMMTAGDRIPRPFGETLKATKPNELLHFDYLTMIEGDNGM
KYVLVLKDGMSGFVELISFADATADNAYQGLIDWFKRFGVEPQWVSDQGAHFRNQIIELL
QRALGVQHHFTTAYTPWANGTVKVVNREILKCVRALLSERKLHVRDWPAVLPVVQAALNG
MTADRLNGVTPLTAFTALPGGAQLRHLLHPHAPTEEWVTAAVQAHLAKVRAALDGMHAEL
VDASEKRRLAARARHARHQGVRLPKFSEGDFVLVATATDRSGHKLALIWRGPKRIIRALN
DYTFEVQDIVVPFAVVIRHASRLQLYRDAARG
Download sequence
Identical sequences H3H3G8
164328.JGI85043 jgi|Phyra1_1|85043|fgenesh1_pg.C_scaffold_135000010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]