SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85054 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI85054
Domain Number - Region: 211-241
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000209
Family Retrovirus zinc finger-like domains 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85054
Sequence length 258
Comment (Phytophthora ramorum)
Sequence
MPLSSCIEHKTLLRICDYELQRPELEVTEEMWKVYFLKGRKSDTRDYARLAAAMRSLTMN
TKLSDAESRVTRLLADFHSILDTEDMDDFPLEEPKLAVKYLCNALQHQALKTTVFTELKK
NANKPLKKSVQAFINWLTPKVQAFCLFETALPDQAVSSRTGTSGNPASTPGKSGSQRDGT
SKKQRSGHGQKNGPLPPRPAPQVPPVKLGSDTKHASPQQEKKCYKCGDKNHLVFQCPQVT
REEALELSEANSTKTSRP
Download sequence
Identical sequences H3H3H9
164328.JGI85054 jgi|Phyra1_1|85054|fgenesh1_pg.C_scaffold_137000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]