SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI85070
Domain Number - Region: 186-206
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00167
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 
Domain Number - Region: 208-250
Classification Level Classification E-value
Superfamily Acid proteases 0.0745
Family LPG0085-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85070
Sequence length 284
Comment (Phytophthora ramorum)
Sequence
MDRSEFPHLNDSQFESVRKMAGIFGMDALQSLAAATPAEQLERVSAFDTYEQGLIAHLRA
AFLPANYEYRQRSRFLACKQGRRELHEYIQEMRELTASLVGNPLHEHIKVTVFMDGLRVG
PARTQLFRVQASTLEEAIQIALQEEYSHRQARTPATAWLGGSTQGGPQSRVPFNGPVPMD
LSLAEQHDIRCFGCGKLGHMKLEVPKVFMDLSVKFEDFNSTERFLVLDMDKYDLILGMPW
LEKHEPWIDWRGKAIGASRPAATDRALDVESSEGNCNDSGTHRS
Download sequence
Identical sequences H3H3J4
164328.JGI85070 jgi|Phyra1_1|85070|fgenesh1_pg.C_scaffold_139000007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]