SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85134 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85134
Domain Number 1 Region: 549-654
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-16
Family Reverse transcriptase 0.0027
Further Details:      
 
Domain Number 2 Region: 153-249
Classification Level Classification E-value
Superfamily Acid proteases 0.0000248
Family Retroviral protease (retropepsin) 0.045
Further Details:      
 
Domain Number 3 Region: 78-114
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000331
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85134
Sequence length 659
Comment (Phytophthora ramorum)
Sequence
MAMRDYVQRTRHLASCMTRYCLTRAEPATLEEAFALALREDYLVTSSYAKTMPAQTRVSV
PEPMEIDAIEASQNRRWSSSGRGRGGQNDLSLNCFRCGKPGHRAAVCRAPAPILAHMKRV
TPDERIPAAQPKNGRGHGDSRLIIVSLYVAGARRPLRALLDSGATNNFFRASCLSILPAG
VPVRDVPGDVVVKLADGKPFRVARREVSLPYTFDGFRSNDNFIVLEMNYAFDCILGIPWL
SRYQPQIDWLARSVKRRRDFDVREVFTHLLVTPRDWPHVTVVDGTSTTHVVRRASDGPLC
TTCAVLLTDDDSVEHPSGYGRARRAVEHPRLPRTRNKAAERTALPATSPTVEQGLPYDFE
TVEQRLPYDDTAVEQELLPRMSGAVEHGLSRLEEGEVSSGDSETSVLSRGSRRTKTSRRS
RRRLKPRRSPVELTTPPIESVCAVEYVGGVPNHARMIKAASPPRDAKSITDLPGLSWKSF
LRDLKAGDIEQVCLITDANPVSDETNAIAHDDTSSRPKSAEPKSAREERFAAQSWESLKA
SGNPVYETAREFADVFPDKIPVELPADRGVRHEIDLVPGSKYCMTRQWPLPRDQVKAIDD
FFEGRRQAGHVPRPSVVKKPTGGWRIVHAFNQLNDATIPAQTPIPRKDMVLDSMCNGSA
Download sequence
Identical sequences H3H3P7
jgi|Phyra1_1|85134|fgenesh1_pg.C_scaffold_143000002 164328.JGI85134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]