SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85136 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85136
Domain Number 1 Region: 284-315
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000155
Family Retrovirus zinc finger-like domains 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85136
Sequence length 330
Comment (Phytophthora ramorum)
Sequence
MSVGSPNTSATHVARADCPHLSEPEWEALQRLSTVIGDAAVATMLRTLSPTEQHGVDLGF
IVKEQRETTARASVSPSATRRVESLKLHVSSYVGREGEPLLRWLVEVGTAITARRIVDPL
SKVAFAMSCLGGRARSWAYGRRLTDPTCFSTYEDFKEELKLAFEPPQNEFRSRAEFLDLQ
QGKHDVHAYAQRARYLVSNIVTNPIDEATKVVTFMKGLRDGPVKIYLFRGYPNTLEAAIA
LAMQEEFSLRQAKLHVNAPRLMPRPVKRPSGGPEPMDLSSATAAGPQQRRGSTNVRCFRC
GNIGHYARECTAPVHAAKSRRGDTGYRHGQ
Download sequence
Identical sequences H3H3P9
jgi|Phyra1_1|85136|fgenesh1_pg.C_scaffold_144000002 164328.JGI85136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]