SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85308 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85308
Domain Number 1 Region: 593-650
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000000000178
Family Reverse transcriptase 0.0067
Further Details:      
 
Domain Number 2 Region: 205-244
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000331
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85308
Sequence length 652
Comment (Phytophthora ramorum)
Sequence
MPTIAQLRAEIDQLNQVMAERTRVPSNLPKFTGKRGEDVREWLFQIENACRINGILIEDT
HTQLTGIAGSAVEKPASGWFLHWSSTTRSEEHTWGIFREHVLQHFEASNYQAVLREKLQR
LKQTADIETYNGEYSALIFRVEGMSILDQVLCYANGLNPSTRSYVKLENPVTLSDAMDLA
VKYEVTHFVEEIQDRGKPFKGKSFRQKGRFKPKAENKRTEDRTCFFCKKPGHVKANCYAW
KKEQAKQGNEQPQIHVAAKNIATRNVLLGCGATTIYVSSRWVTEQQLQTTKFSDKNIRVK
LGDNQIVEAELEVLPLEIHASGLDEAYTCVAVVYAIPDEFDCILGIPFFEDVQPQIDWRG
RRIQGTEVKTLHWKRSGATCGPIEEGEPVIASGLRRSVEAKRPDSCLGAALETDVKSVDG
PDRDLVQNETPSVVCGQQEDASTGKGPVEERDVESPRREGAAEVAQESSSAQGKSTVVEK
MFTIGVVNEVGVETKYITRKKLRKFLRIKTKSIDEPDFMLVLTNETIKQVARSLQRRDHP
DNVGSAKAQRYLETDWDSFKDNPAFQLFVEYKDKQQREIVRWVEDMSDGELFYLNSNTVR
QSIPMTRKEDILDTMSGAYWFSTMDLMSAYYQVRMREEDIKYTAFQAPSGLW
Download sequence
Identical sequences H3H431
164328.JGI85308 jgi|Phyra1_1|85308|fgenesh1_pg.C_scaffold_161000011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]