SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85429 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85429
Domain Number 1 Region: 552-838
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.11e-45
Family Reverse transcriptase 0.0027
Further Details:      
 
Domain Number 2 Region: 1016-1173
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.4e-31
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 3 Region: 1320-1374
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000321
Family Chromo domain 0.0065
Further Details:      
 
Weak hits

Sequence:  164328.JGI85429
Domain Number - Region: 351-456
Classification Level Classification E-value
Superfamily Acid proteases 0.00199
Family Retroviral protease (retropepsin) 0.026
Further Details:      
 
Domain Number - Region: 296-319
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0942
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85429
Sequence length 1485
Comment (Phytophthora ramorum)
Sequence
MPKRRADDSSDEEESSEYSKPMPVPIFAPILPPRLSSISHKALVKWDKLRMEYEAKMRAR
CRSSGEDYNLVTQNVKESFDLRLLETFCALRLRKDVVDVTEGQLIAEIKHLLGKVKNDDL
PDIKTLCAKELRMDLSETDVDARVLAYFQRFHEVVLENGLEEVFSGDDGEKEKCKRLVSC
LAPPVLKADVKSAVRWTNKEAGKSIQKLYTLIYEKAVEHERHFQQNKRMRLMVKDKISLP
KSAKNVEKSTTAHSKKPPRNDSGKRFLSKKTDTKVEKKIDQKTDKTFKPSISRKEPPSPC
PKCQEMHWLSDCTKATDAEKIVLRQKLREANKARQSRVKRLKELMPPTSRTVTINGVLDL
PCCPDTGSDYTVISRSQWKLLLDVDPSVQEIPLETPVCSQSYGAHPVVAEKKAMLHVLIH
TAAGPVQPVEAVPCLIVDTDDDEFIIGQDLLIALGIDVDRQLEQLASHREDDTGGDPFDL
EADERPMNPSHVASDEEVRAAVETLIERALEHNFPPEKVDKLRTIVHMYDVWRLELRDDP
PARVPPLETCFATLLYKHLLVWIDDLLLYADDIDTYLGKLDELFSLLNDFGLKLSVKKSS
LYQQEVKWCGKIIDANGVRHDPARIDSLRAMPYPSTAGELQQFLCAINWMRESLIDYARQ
VSPLQHRLDEALAKTRRTKRVAAGILIELSAAERAAFDNVKDMLASAATLAFPNDSATTC
LLTDASDIGWAVIVTQVKDFDIKMPVQDQQHQLVECLSGTFTGSQLNWTVIEKEAFPIAL
ACDKLDYLLLRPQGFRMFCDHRNLIHVFAPDENVKKHVKGKLLRWSMKLMNYNYVIEHIA
GPNNVWADMISRWAGNHVPVTSRISRIRTDTPAAPSAASQQELAREVTGPIISTLRPLDD
DNFIWPTFVEIILVQSRYEPPSGAVRTDDDVFTLRDRIWIPTEASDLILRLFIIAHCGAQ
GHRGHAAMVEHLRRLFAIEKLNTLASTFVRQCRLCLHSKGGNIIPRPWGETIDCCERNGV
LHFDFLFMGESFGDSKYILVLKDHASHFCELVVADTADSTVTVEAFLAWHSRFGLPPVWI
SDQGSHFKNEVVSELSRRLRTQQQFTPAYCPWINGSVERVNRDILQVIRTMILEYKINHS
DWVYLVPMVQSSLNHTAVPSLGHKAPVELFTGLPCPTPLKEFYLPGSGEFKEVPASDKID
DFLVNLRSSIQDMHKAVEEQRLKQRLLNKKRERGENMVNFMEGDYVLRSRVDEKNGNKLL
VTWVGPYRVMRADVHSFMVQHLITGAELDVHASRLKFYADSSLDVTEELLEHISSQGIIL
AVEKLKEHQWNDNIKDYEILVQWKGLEAIEDSYEPLTTLSRDVPKLVNQYVAAADQELKA
HWQRVTMTGDQQLQEPIVATEMVRPTDMSRRRSSRRRKQPRSTTTTTTQASDKGDTVAAT
LQTSSDRPGLENNQPDANTPKRLTQVRAEDQGVSRRTRSQTARAD
Download sequence
Identical sequences H3H4D4
jgi|Phyra1_1|85429|fgenesh1_pg.C_scaffold_184000014 164328.JGI85429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]