SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85448 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85448
Domain Number 1 Region: 749-1091
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.89e-96
Family Reverse transcriptase 0.00022
Further Details:      
 
Domain Number 2 Region: 246-282
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000733
Family Retrovirus zinc finger-like domains 0.0034
Further Details:      
 
Weak hits

Sequence:  164328.JGI85448
Domain Number - Region: 321-417
Classification Level Classification E-value
Superfamily Acid proteases 0.000219
Family Retroviral protease (retropepsin) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85448
Sequence length 1273
Comment (Phytophthora ramorum)
Sequence
MTKFEMSEDQLAGPPVMTLEHAAFPHLTSIEWQALHRLAAVSGETVVTLLLSSATPDQQR
QAIQEFMDRELAEAKRRVSTSSHASRNNAVKMETSSYSGEGPDRLPLNRWFREIDIAIAS
RLIEAPSAKYAFPTLEALQSDLRLAFEPPQDESRVRATFFALKQGKMAMRDYVQRTRHLA
SRIVTKPIDMASQVHVFVFEDFALALREDYLVTSSYAKTMPAQTRVSVPEPMEIDAIEAS
QNRRWSSSGRGRGGQNDLSLNCFRCGKPGHRAAVCRAPAPILAHMKRVTPDERIPAAQPK
NGRGHGDSRLIIVSLYVAGARRPLRALLDSGATNNFFRASCLSILPAGVPVRDVPDDVVV
KLADGKPFRVARREVSLPYTFDGFRSNDNFIVFEMNYAFDCILGIPWLSRYQPQIDWLAR
SVKRRRDFDVSEVFTHLLVAPRDWPHVTVVDGTSTTHVVRRASDGPLCTTCAVLLTDDDS
VVYPSGYGRARRAVEHLRLPRTRNKAAERTALPATSPTVEQGLPRVYETVEQGLPYDDEA
VEQGLPHAIKTVEQGLPYDFETVEQGLPYDFEAVEQGLPYDDTAVEHGLSRLEEGEVSSG
DSETSVLSRGSRRTKTSRRSRRRLKPRRSPVELTTPPIESVCAVEYVGGVPNHARMIKVA
SPPRDAKSITDLPGLSWKSFLRDLKAGDIEQVCLITDANPVSDETNAIAHDDTSSRPKSA
EPKSAREERFAAQSWESLKASGNPVYETAREFADVFPDKIPAELPADRGVRHEIDLVPGS
KYCVTRQWPLPLSTPSGMLWEWLVMPQGLKNAPATFNRMVSHVLRPLRDFAPSYFDDFFV
HSHAEEGLSAIDVHLRHLRQVFQVMRENKLYANLKKCVFCAPEIPVLGCYVSKNGVRADP
EKVSSICSWPPPSNPTELRQWLGLANYLHKYTKGYAGLIQPLSSLLKKDATWSWRPEHQV
AFDSVKKSLASAPILMLPDDAKPFHVVCDASDFAIGCALMQFDNEGCERVLCYQSRQMKP
AERNYPVHDKELLAMRYALIKFRVYLLGEQTFAVYTDHASLRTAMKSPHLSQRMARWLSF
FAEYNFVVHYKPGKNNILADALSRRPDYDPRATRGRQVIDEDEDDEDHCAMCLTSGVNLM
NVTPEMPLREEIAVAYNDDAVYAAILAHLLSPSDKTLRALPNNTRNQINRYQLDGDLLMY
SIDRFDAPRIAIPNDDDLRARIIHEFHDSPVGGHLGREKTFAAVSRDFYWPHMYKWVRKW
VRTCSPATPADCN
Download sequence
Identical sequences H3H4F2
164328.JGI85448 jgi|Phyra1_1|85448|fgenesh1_pg.C_scaffold_192000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]