SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85504 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85504
Domain Number 1 Region: 114-169
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000000358
Family Retrovirus zinc finger-like domains 0.0011
Further Details:      
 
Domain Number 2 Region: 61-112
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000136
Family Retrovirus zinc finger-like domains 0.0037
Further Details:      
 
Weak hits

Sequence:  164328.JGI85504
Domain Number - Region: 174-193
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0105
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85504
Sequence length 214
Comment (Phytophthora ramorum)
Sequence
MAEEVLSEERKLILQNRRELRKAKKAKAKQFKQEKQQARREKKAEIVAKIRAKREEAQYG
ADNSQSQDGCWLCGETSHRKQDCPNRAAGDVNKTCFQCRRRGHTSHNCPQNGGGGFGQQQ
QAAVCFNCGANDHALRDCQRPMENGGATYATCFVCGQQGHLSGKCPQNTMGVYPKGGCCK
LCKSVEHLARDCPVGNISVDGSSGAKQNKKLTLV
Download sequence
Identical sequences H3H4J9
jgi|Phyra1_1|85504|fgenesh1_pg.C_scaffold_207000001 164328.JGI85504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]