SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85518 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85518
Domain Number 1 Region: 334-482
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.15e-39
Family Retroviral integrase, catalytic domain 0.0033
Further Details:      
 
Domain Number 2 Region: 684-909,945-1129
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.78e-36
Family Reverse transcriptase 0.037
Further Details:      
 
Domain Number 3 Region: 235-265
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000327
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85518
Sequence length 1196
Comment (Phytophthora ramorum)
Sequence
MSPSPVFPAQDQDPDYAFAMDATPTATARINKFNGTNFHTWKFKMQMVLEERELWEVTSG
EVKLEHCTTTADQATFKRKSRKALAIICLAMEDSQLPLVRSAKDAHDAWSRLEGHFEKKS
LANKLFLRRRFFTTMMDEGDDVLEHINKLKTLAEQLDAVGAPVSEDDLVITLLGSLSESY
QFLITALESRADSLSWELVTSRLLHEDMKRKEQGGGGVDGTAHGQGQAFMVNNNKRKGRP
VKKTGACHNCGKQGHWIAECPSRVQNDAERYRSQRANVAQDEEDPGDYLFSVGRTSSTAK
PSDMWLVDSGATQHMTSSNKYMRNYKTMAPVDTPTFGGKRYFVTFIDDKSHFCVVYLLRN
KSEVAAKFAEFVAFAETQTGKRVQTLRSDNGGEYTSGAMVKFCADRGIVQKFTPPYTPQL
NGVAERMNRTLVECARCMLEHAGLPKTYWGEAVMTATFLRNRCPTRAISHDKSPHQVWTG
KKPLLANLKVFGCHAYVHVPKAKRTKFDARSVRCRFLGYSEHEKAYRFEELESSRVLVSR
DAQFMEDVFDSGRRDYHQREVVVIQDEETTDQDSSQSDDDDNEEEEEKEAARDEDFGPGN
KRHPRTQSLEEVTEVPSAKRYASQSRHQTLDEMSAAAQESQDFEAAYVVDSVGEMRTTFK
SAMESSDAVKWKEACDSECDSLLKNDTWDVVPLPKGRKAIGCRWVFRVKENQAGEVERFK
ARLVAKGFSQKYGIDYDETFAPVAKFTSIRIVLSLAAKYGLKLHQMDVKTAFLNGVLDED
IYMAQPDGYVDEDHPDHVCKLKRSLYGLKQSPRMWNQTIDDFMLKLGFKKCESDHCVYLK
RDGQDMIFVALYVDDLVLASSSDELLESTKHALSKRFEMTDLGELEYFLGMEIKNDHGSG
KVTVRQTKFLKSILTKFGMQDSKPVKTPQDPGLKLTKNMCEGGCQHEDTMKNVPYRSAVG
ALMYLMVATRPDLAAAVGVLSQFSADPCPTHWQALKRVLRYLQATPTHGLEFSREDSVGM
CGYSDADWAGDIESRRSTSGYAFMMNGGCISWRSKKQRTVALSSTEAEYMALSEATQEVV
WLKVFLCELGEMASDEAVKIYEDNQGSIALAKNPQFHKRTKHIDIRYHFVREKVEDGQVV
LQYVSTTDMLADMMTKAIPATQFSVLRSKLGIQGAIAVESSGSVVKKAPRAAAVYR
Download sequence
Identical sequences H3H4L3
jgi|Phyra1_1|85518|fgenesh1_pg.C_scaffold_212000001 164328.JGI85518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]