SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85588 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85588
Domain Number 1 Region: 641-1112
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.56e-92
Family Reverse transcriptase 0.0000929
Further Details:      
 
Domain Number 2 Region: 1270-1427
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.9e-33
Family Retroviral integrase, catalytic domain 0.0072
Further Details:      
 
Domain Number 3 Region: 1573-1635
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000118
Family Chromo domain 0.0087
Further Details:      
 
Weak hits

Sequence:  164328.JGI85588
Domain Number - Region: 419-480
Classification Level Classification E-value
Superfamily Acid proteases 0.006
Family Retroviral protease (retropepsin) 0.0096
Further Details:      
 
Domain Number - Region: 345-377
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0111
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85588
Sequence length 1677
Comment (Phytophthora ramorum)
Sequence
MGDKDDVNVDELTARAAELQLESAASRSPRSPGLRLQIPNPFEREDEVMETASQASPMGH
AGTSRVAAAPTLPQPPRFEGRSMQDRRDFMHKYETYLGAINALQTQWSGAFAMPVGACIE
SKTKRMIARYEFNQLPGAITEEQWVAYFLQAKTPSPVDYTSVDEAMKALRMQTRWPEPES
RMMNLQSDMEAILDRFNLTDLAFQHEQRRLVKYLAAALAPPGFKAVINTKLTLQENRTYK
HEVVPFCSWVTQLMKEFMTWEHAAQVSGGQPGPSAQNQPRSGSGGRGGNGGRGANTGRGA
GGGDNTPTRGAQGSPSIRGGRGDQHGRGGRGYGSTRPQESTRPQESPSRGPTPETRSGRG
ACLKCGSSEHQVRQCPLCSSEEAVELLRGRREQHAGTRGVSMNKFDVVTASDSVLTAGED
RGTVEAAVEGVPVKALLLDSGADTSLVARGVLDSIGQAGKPVAVRTIHPVRLSPVGGREV
VVQRMATFSEIVLTTSAGPLLLRNLACFVEEDNSRMELTVGRPIMKILGYSTDKLLVEAR
DAQAEWELGGDTSPKVDKDQSSPTSLQRICRLAVAVAAQDPGPDAEEEDIYRHETRTALP
CMQPTNLAEVTHYLESKVEIATRMGLTLDGSAKLRGILQMRADSFRLEFGHDPPVRVAPM
QVRLKPGATPIRAQPRRYSPNDRAFLDRHTTTLMKHGLIFKNHRSRWASAPRIVKKKEQA
DDPLADPRMTIDTRSVNERTEPMPWPMPVLEVVIGELEGAKVFFVLDWFRGYWQLPLHPD
SQEIYSFVTHRGIYTPTRVPMGATDAVAYCQGVVEEIFGDLLGTCILAWLDDILGYAEDE
ASLLEVLDKVLERCEKFGLKLHAKKCQFFATEVKWCGRMISAQGVRHCPERIQGLVEMQA
PQTAGDLQQFLCAVNWMRQSIPEFTRITAVLYDALDRAAQIAGSRKKVKLARVRLEDVSW
GADEMAGVEAVRDALLNMVPLAHPSPTADLCLYSDASNDYWGAVVTMLDPEELKLPRAEQ
HHRPLAFLSGRFVGAAQRWPTIEKEAFAIVEAVRRLEYLLLRPRGFHLFTDHRNLVYIFN
PYATDGMMARYQADKLQRWALALMSFRYVIEHVPGEENAWGDLLSRWGAGPPLEATRTAI
RAARLAVVERVSPLEEADFVWPSEQEIRAVQQAAGAAAHPGVQWNEERQLQMTSTGQVWI
PPDSGELQQRLCVVAHAGASGHRGAAATLKSLSTCFFWPTMGPDVTTFVNECLHCMVAAG
GRIPRPFGETLRATRPNEVLHFDFLTMIESTSGVKYVLVLKDGMSGFVELLACTHATSDH
AYQGLIDWFKRFGVVHQWVSDQGAHFRNQVVERLQRALGAHHHFTTAYTPWANGTVEVVN
REVLKSVKALLSERRMHVQDWPAVLPVVQAALNAMPADRLDGRSPLTAFTALPADSQLRS
ILHPRSPTQATLEWVDSEVRSHLTAVREALDNMHAEMVSASEKRRRAARERHARRQGVRL
HKFSEGDFVLAATATGRSGHKLALVWRGPKRILKALNDYTFEVQDIIEPFAVTIRHASRL
QLYRDAARGRVEELQEQAIYGEGGHLVEALLDCRLSPDSHRWEVFVKWFGLDDIEASWEP
ADIIKQDVPGLFQVFVDDQPEARSRRDMAAALAGPDRDDERPAQRAPRRRQPRQPRT
Download sequence
Identical sequences H3H4S7
jgi|Phyra1_1|85588|fgenesh1_pg.C_scaffold_250000002 164328.JGI85588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]