SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85599 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85599
Domain Number 1 Region: 87-115
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000174
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85599
Sequence length 141
Comment (Phytophthora ramorum)
Sequence
MELQNLEAAMAGAPFSEDVKVTVLMDGVRPGPVRTELFRRQPTTFNDAVHIVMLEDHCVR
SAQGYAGRAEATEGPTPMVISSAESARPQRNQRTSGRCFGCNQLGHFRRNCPTNPWKTGR
GKAAPLLNVIESAMSENGDSQ
Download sequence
Identical sequences H3H4T5
164328.JGI85599 jgi|Phyra1_1|85599|fgenesh1_pg.C_scaffold_264000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]