SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85655 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85655
Domain Number 1 Region: 46-240
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.02e-45
Family cAMP-binding domain 0.00052
Further Details:      
 
Weak hits

Sequence:  164328.JGI85655
Domain Number - Region: 6-42
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000691
Family Voltage-gated potassium channels 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85655
Sequence length 358
Comment (Phytophthora ramorum)
Sequence
MVTTANDVNPTTPIEKLFTSVMLFVGIVINASIIGSAANLLANLDKEEIARKNQMDSIND
YLRFKKVPLNLQNKIRRYYDYALTTRLQDPTETLFADLPDRLKLLLKLNLHSEFVRKVPL
FRALSHSGVVAIIQCLAPVVAMPGEIIIVCGEVASEFYFIKTGQVSLCVPGLVNSIPLGN
LGEGSFFGETSLLTGEPTTAEVKAERMCELMYLDKDDFEAIVDRFPTFFLAVRRISESRM
QTAQNIQKMSKMNRRPTQILKIKKISFRSVAQAAVLKARFGDRLETLTSKGASGRSEGRV
GSIVGGGRRLMSTGRRKPISSFSVNFIERLSLAQARHLTRLRGMRHMQSNAEEDIFWD
Download sequence
Identical sequences H3H4Y2
164328.JGI85655 jgi|Phyra1_1|85655|fgenesh1_pg.C_scaffold_274000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]