SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85763 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85763
Domain Number 1 Region: 453-613
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.91e-45
Family Retroviral integrase, catalytic domain 0.003
Further Details:      
 
Domain Number 2 Region: 867-1084,1123-1305
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.38e-22
Family Reverse transcriptase 0.062
Further Details:      
 
Domain Number 3 Region: 212-249
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000349
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85763
Sequence length 1358
Comment (Phytophthora ramorum)
Sequence
MTTTSAKKAEVVLGSDNYFHWEFAMRMTLARKGLLAHVQLVKDPSEMTDAWLLNDMKALG
LIAQGVAVEHHTKIRSATSAIMAWNTLRDFYNRTTMHNRVTMTRRLHEFKMEGGVTMAKH
LDDFDELIVGLQTLGEPLDEARQLVILLSSLPTEYELICSIVENAKDFTLIEVKEKLLKE
YERLDKKEGAERALKATANGSKFRCAKTFRGGKGSKAFGSRKNGGFKGKCFNCGQVGHMK
RDCPDPNAGNNDDDAVFAVGKSRSAAWLIDSGATAHMTPHRNDLFEYKDLDSDVEVTIAD
GKKIRVVGTGSVRLTGIDGTRIKMIDVLFIPGLDRQLLSVSRLAERGMIVEFQKKSCTIW
NKSKAIALGKKVGKAYMLDCEKDMAHYVEYAGVDSEWELWHARMGHLNKDALAKTQRATT
GMPTLDHKSMTICGGCMKGKQTVAHFPSRSLSKTTKVLQLVHTDVMGPMKTKSKGGARYV
LTFVDDYSKYIVAYFITKKSEVPVKFKTFMNLYENQWGERIKCLRSDNGTEFVNKEMDRL
CALNGIVHQKTVPYSPQQNGVAERMNRTIMEKARSMLYYKGITTMWWAEAVSTSVYLINR
STTSTHSSMTPHELAFRDKPRLDHLRVFGSVGYAHVDKAKRTKLEPKSFKCMFLGYAENS
KGYRVYDLESNKVKVTRSLKLDEREVDGIYESTPTESTTDIHSTEDVDEVVQLEQEQQSA
TQAPVGSVEDNHEEDAAMPEAESDDSMRHGLTTYRTTPGADFSDDLVFHPERERVRRPRD
LILALEDEYKVNDEEDPNNDDHFWPPSPKRARVDEDGLLAEAVLAYAASVGDADDAPTTY
QQAMKSNEASKWIKAMNSELKAHADNGSWTLVRRTSGARPIGCRWVFAKKRNEHGRVVRY
KARLVAKGFKQKFGVDFFETYSPVANMNSIRVVLSVVVAKAYVTEQLDADTAFLNSDLKE
QVFMEVPYGILNAEHMMCKLDKAIYGLKQAASAWHQTIHAVFMKIGFHSCGADQCVYVKG
TKDNYVYVCLYVDDMIIAAKTNKEIDEVKMALKSAFKMKELGEVKFILGMEIDHDRTAST
LMIKQTRYIDDVTSRFNQQDAKAVVNPCESGMKLTKMQSPTTNAEREDMRNKPYRSLIGC
LLYITTCTRPDVAYIVTQLSRFLENPGQQHWKAAIRVLRYLKTTKEFGIVYNGNNGKVAM
EAYTDADWGSNLDDRRSVSGIMIMVGGAPVIFKSKYQRTVALSSAEAEYMALSLCTQEVL
WTRTMLKDLGHEQVGATQVWEDNQGAIALASNAGYNARTKHVDIRHHFIRENVARDIILV
GYVGTEDQLADMLTKALGTKRLTFLVKASGICTKLAHH
Download sequence
Identical sequences H3H572
jgi|Phyra1_1|85763|fgenesh1_pg.C_scaffold_305000001 164328.JGI85763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]