SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85792 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI85792
Domain Number - Region: 339-431
Classification Level Classification E-value
Superfamily Acid proteases 0.00819
Family Retroviral protease (retropepsin) 0.044
Further Details:      
 
Domain Number - Region: 271-294
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0164
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85792
Sequence length 543
Comment (Phytophthora ramorum)
Sequence
MAISSGSTPLFTPIVPPEIKSISHEALTLWKKERREYEAKLRARCRVSGEVYEAVVLPII
ESFDPDLLDTFCELRLNLASVDVTEGMLIAEISNIISNVKNDTLPDIKALFRSQLRMNMT
ESDVDARVLDYFNHFGIIMRENGLMNCFEGSDGTREKCKRLAASLHPATLKSEVKQCLRY
THKPAASNPRLLFELIVDKAKEHERQFQRTRKRDTTSGRDNDTQKTSKPKDKKRAWTNKR
AMATVAENKSKTGAPTAQADHRPQSISSRPPPSPCPKCKEMHWLRECTKATEKEKAELRE
RMREAFAAKKARIKRLGELLPDTERLVTLNGALELPYCADSGSDHTVIGRSHWEQLQALD
PSVQPEELDIPVRNQTFGSVQVTADKKARLHLLIHTAAGPVEPMNAVDVLIVDVDDDEFI
IGNDLLMTLGIDVDRQLEQLADRGDDETCGDPIELEADDPPVSTATQPSDDDIFTAVECL
IARAVENGFPADKVEQLRTIAHAYDVWRLELRADPPAKVPPLEVRLQDGARPTKFVGRAP
SFR
Download sequence
Identical sequences H3H596
jgi|Phyra1_1|85792|fgenesh1_pg.C_scaffold_313000002 164328.JGI85792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]