SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85798 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85798
Domain Number 1 Region: 747-870
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.31e-30
Family Retroviral integrase, catalytic domain 0.0028
Further Details:      
 
Domain Number 2 Region: 497-531
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000116
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85798
Sequence length 883
Comment (Phytophthora ramorum)
Sequence
MAGSQKASCPRQAAALSANRSPRSASSPPGHSPPNSSARSASSAAGHNASAPVARTTLSV
AEYYSKQQLKQARVAMSAPKSSADAPKPRIRRANETLFEGLEEGEEVDYGSDTCLREEDE
EPPRGRTTDKRDLRTPNPFVERSDAVSGLTALRTTSSLPSRDEDEPMEANVVSNNLDEVQ
SQQLAAMEEAPRAQRPIARPLLHPSRRDYGFEPRDPNEVARLAASQLLNDYVIGPAVHSN
EEVAQREDLRQRLLTPQLTTQREYRERLQLQARGASVPQMRTGCCVCMCECAPGVGASPS
TDTKFKVEPFDGSNYSLWSYKMKMYLMSKGLWEAVSGEAGSTAKEQQAHAAIVLNLNDSQ
LMHVVTSTTAKEAWDTLKKFHKTQDMANRLWLKEKFSAFKFTASSVGKHVTELEKLVMEM
KNAGCEPTEEDVFATMLRSLPSSYEALVQAFRMSVSEFKLADLVSKLIAEEVRQKDSNRI
EEATALLAGKGNGKQQKKKKNPRGMRKKGPFGKCFNCGKPGHYARDCRSEASPDEDVQDQ
SNVAFHVTEAFASECWVMDSGASAHMCKTRDAFQEYSGVKTARTISSAKSSASLKILGVG
TVVLRVWTGSAWINARLENTLHVQDLNKNLFSLTAATARGMTVTMDSEQCVVKRGSQVVA
TGRKQGKLMFLNIEGGDECHAAEDNMDLWHRRLGHASFGTLNPMIKDGKLKGALAEPGTV
CATAKQARKPFKSTKEGLEARESARKDTTVCSDMLGPVTPASKSGYKYIVSFIMMKSRFV
TIYPLHKKSEVCEAFKKFLKEAETSAGIKVKVLRSDNGGEYCNAGMVALCDEKTIKQEFT
VPYNPQQNGMAERMNRTLVEMTRCMLGESGMDKSYCERERVLS
Download sequence
Identical sequences H3H5A2
164328.JGI85798 jgi|Phyra1_1|85798|fgenesh1_pg.C_scaffold_315000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]