SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85813 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  164328.JGI85813
Domain Number 1 Region: 1154-1604
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.76e-101
Family Reverse transcriptase 0.00027
Further Details:      
 
Domain Number 2 Region: 1993-2147
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.2e-29
Family Retroviral integrase, catalytic domain 0.013
Further Details:      
 
Domain Number 3 Region: 1659-1783
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000152
Family Ribonuclease H 0.014
Further Details:      
 
Domain Number 4 Region: 2310-2376
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000923
Family Chromo domain 0.0039
Further Details:      
 
Domain Number 5 Region: 774-870
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000863
Family Retroviral protease (retropepsin) 0.027
Further Details:      
 
Weak hits

Sequence:  164328.JGI85813
Domain Number - Region: 685-725
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.068
Family Retrovirus zinc finger-like domains 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85813
Sequence length 2392
Comment (Phytophthora ramorum)
Sequence
MVRVPGSSGDSQGFHRESNQEDVKIKIKPGNESSTEDGSPSTMLIAQGSSSQQSTGRDSD
DTKKEAGSAMDLEEKPYPPPQVPSGTPADRDANRDPPDEDPMAKAKGSSPKTTPPISRSA
SKKRSPTGRTKMKAPESDAEDPEDRKMWTEEQLESAFYRKDLYKFLAEDRVMKIMHPKLI
GDLQGPAKAPREVSNMLDATKLLMRMLREAGIVLGAFDANDLFDLKPEAIRESTLTLFAK
LTPIVGSIVPIQRSTSPTTRSQTGSSHYASATSEAGSDSSVEPQRMSLGPSGAAMLRSRM
DAPVIEPSIENRQAQSRSTPDRMQTFFNSAMERFLKERQQASTAPQVSSRTVLDRPVADR
TQTPIVQDVEMESVGSNHPEHSHPSEYDPDNLSVGVPTRAAVASAETSGSGSFSATRIRV
SAISELKEFSGKDRDEDRARSWFSKMKSAFIRDQAPDSEKCLVFGDLLTGPARNWYRQLS
RTTRNNWKSLSQTFQTQYCGRGVSVARQYYHARKRSEESPLEYLHRLNVAGLRAHLLIKD
GSIEVRREHVDHFIETLDDRELANQLALLRISDADTLEETLRSRQRAKARQGKTVYGSIK
PKPKAPTGVAPSANARAVRAIRKTAASSDSEPGTSESEGEGDLRRIYLAATADQPERSPP
DRDPRRQTRDPNRRRFDKSAEPPDEDPPRKPCSHCGSTKHSELGCWQRLTCEKCGRKGHP
TDRCLFTCKACGEIHGAVAVGKVTMALELLHGESRGYWKYHVPDKKFRQAKAVGKINNEK
ATLLFDSGAEVSILDAAFARKVGCYIDNSQELECEGVGKNPYMAEGRTQIKITLAGSLVY
YFDAWVGPPTGGQDLILGMDFMAPAGIRLDLADGSINLPDEVRIQLAGRRQLFGDKVQQI
KLGEHSVIDVGRSVELCKGFITPEHRKLWVTRGDRWVPSVVAGFGRTRYLKITNISDQKL
VLQDDTRVAMWLSSGQVPRIPGFVLIGSRRYTEWQNLAFQATTDQIEKEEIDAEPEGPMV
DRPRYDPPRKILRRDRSTPKPVVATITTEVPAEAVAAADPREETPINDLDRAEDEEVCLH
EGGDLFAEDVEGHMAILPEVSSSTDEVSIEDIQVGDPEANTPEEIDRLRQIIWRRRHLLI
GKGNALPPAANGAVCDIDVGGATPVAQRVRRVAPQFREKLSELIKSLLSAKMIEPSTSPW
ASPIVIIIKKNGVDIRLCIDYRLVNSLTRLMVYPMPLVNDLLEDLDKALWYCSLDMASGF
WVVSMTERARKISAFVTPFGLFEWTRMPFGLKNAPQIYQRLIDNALYGHFRISPNADPSK
LVDVFKEGEPEDEPRPSVLGRRSYIDDILISAGSWDDVCEKVEKLLDACDRWNLSISVVK
SFWGYRKVDYLGHRVSAEGLEAKPKDLESLERLPFPKTLRSMQSFLGSLNYYSRFIEDFA
VYAAVLYELREVDFHEINRIGNADQTGKANDRWVRAKTAFNLLKSKLVTTPILRHFDSDR
QPVIVVYANKWAISAALVQEHEGTYWPVIFTSRTLKSNELNYGMVDKEVLALLRILDVCY
TTLTNRSIKVLSRYSTLAWLLKSTGFQGRLGRWAALLSEWTMEIRKCTKGEDEILGAIAA
SITPRSKVDDALIAIAPVKEPKQTIAKLPPTVGLDERLLVVSFDGSARVKRSAGAYSAIV
WQLPEWSIVAAASEFTVDLTVNEAEYRGLLLGFKLLSDQDKGRVIICGDSNLIIRQMRGE
IDCKAPGLQVLREKAMGQLKAWPTHDLLHVKRDWNQSADRLASTALQREAGAIVSAEGEI
DDLIAINRLGEVLKTANDDSIVQVTAVTRSARRTHQVSASLQETIVQRMRSERIARAQNE
EKWIGDLKAYLRGDVADLSSKDARLCAKIAGDYDVGEGDLLFYCGNITRTDENRDSMARL
VVPATLHQDFLHHYHASLEGGHQGIGRTYQRIKAHFHWRGLFKSVQRFVGQCLDCETGKG
RPVVQGESPGNVQATYPFQIIAMDHIPSLPKSFKGNTELLVWVDLFSGYVIAKASASRTA
QTIAENYEECVFRRFGASEAIRHDREPGFMSDFFRAFNRIMGQRQRATMAYRPQANGTAE
RMVQTLTRALKMYVADTNQQDWDEYAERLTFAINTAHDRVRGDTPFYFVHGWDPRSTLEA
SLPLGSTRRCDHEPRRWRYHIQQQYQRARKEVNERVKAAIQARADQHNEGVRPHEIEAGT
RVWLYLDRVKEGYARKLAHMWHGPFRVIEMVGRYAARLEVAHTEYRLFPIVHVSKLKKVK
SFPDRPNATLTTHEENRFDFDEALLPEDSWENDLGDNEFEVEKIVDVRSGRKTRYGRVHR
EYQIYWKGYADPSWVDEADLNCGALLYEFERNRTSRSRFGVMQSHEVAEDNQ
Download sequence
Identical sequences H3H5B4
164328.JGI85813 jgi|Phyra1_1|85813|fgenesh1_pg.C_scaffold_320000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]