SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 164328.JGI85914 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  164328.JGI85914
Domain Number - Region: 269-300
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00209
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Domain Number - Region: 107-147
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0286
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 164328.JGI85914
Sequence length 571
Comment (Phytophthora ramorum)
Sequence
MEQDDYGTRAGTVPLFAPPLPPKISSISHEFLAKWKIKRREYEAEMRARCRVSGENYDVV
VTPIMESFDAELLDTFCELRLNQASVDVTEGMLIAEIEHIAGSVKNKTLPDIKTLFMSSL
RLNMTESDVYARALDYFNECGKIVRANGLTECFTGNDGVREKCKRLVASLHPATLKAEVK
QCVRFTHKPAATDPRLLFELIVEKATEHERQYHRLKTKRRNEPESNKDKVKVKSKPERFT
DNMKKPWRTNPSRVPTPDNPRASMTTKTKPSSPANLPPSPCPKCHEMHWIRDCPKATDAE
KDQLRKKLREANMAKRARLKRLGEYLPTPGRRVTLNGVLQLPYCPDSGSDYTVICRSHWN
QLVEKDPSVKAEDLAIPVLNQAFGSTWVKADKKAKLHLLIHTAAGPVQPMGAVDVLIVDV
DDDEFIVGNDLLNLLGIDVARQLEMLADRGDDETSGDSIELEADDLPTTASAYEPSDDDI
FAAVERLIDRAVDNGFPLDKVEQLRTIAHAYDVWRLELRADPPANVPPLEVRLQDGARPT
KFDGRVLFYRSRNLRTSWTYDKLRTIEDPTL
Download sequence
Identical sequences H3H5J9
jgi|Phyra1_1|85914|fgenesh1_pg.C_scaffold_368000001 164328.JGI85914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]